DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr59e

DIOPT Version :8

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster

Alignment Length:381 Identity:74/381 - (19%)
Similarity:153/381 - (40%) Gaps:70/381 - (18%)


  Fly    50 LKWLNVTHRIITFTRFFWVYIASI------SIKTNRVLQVLHGMRLVLSIPNVAVILCYHIFRGP 108
            |:||   |.:.:.....:::..||      :::...:.::|:.|....::..:|:::.|.:...|
  Fly    28 LRWL---HTLWSLFLLMYIWTGSIVKCLEFTVEIPTIEKLLYLMEFPGNMATIAILVYYAVLNRP 89

  Fly   109 EIIDLINQFLRLFRQVSDLFKTKTPGFGGRRELILILLNLISFAHEQTYLWFTIRKGFSWRFLID 173
            .......|..|:...:....|.......|:|.|.|:...|:  .|....|...:  .:.:.|...
  Fly    90 LAHGAELQIERIITGLKGKAKRLVYKRHGQRTLHLMATTLV--FHGLCVLVDVV--NYDFEFWTT 150

  Fly   174 WWCDFYLVSATNIFIHINSIG-YLSLGVL-YSELNKY---VYTNLRIQLQKLNTSGSKQKIRRVQ 233
            |       |:.:::   |..| .:||||| |::...:   |...:|:.|::|..   .|:..:..
  Fly   151 W-------SSNSVY---NLPGLMMSLGVLQYAQPVHFLWLVMDQMRMCLKELKL---LQRPPQGS 202

  Fly   234 NRLEKCIS---------------LYREIYHTSIMFHKLFVPLLFLALIYKVLLIALIGFNVAVEF 283
            .:|:.|..               :..|:.:|..:..::....|....:|.||.:.....::.||.
  Fly   203 TKLDACYESAFAVLVDAGGGSALMIEEMRYTCNLIEQVHSQFLLRFGLYLVLNLLNSLVSICVEL 267

  Fly   284 YLNSFIF----W---ILLGKHVLDL--------FLVTVSVEGAVNQFLNIGMQFGNVGDL--SKF 331
            ||....|    |   :||...:|.|        |:::|: |..:.|..|: .|..|..::  |:.
  Fly   268 YLIFNFFETPLWEESVLLVYRLLWLAMHGGRIWFILSVN-EQILEQKCNL-CQLLNELEVCSSRL 330

  Fly   332 QTTLDTLFLHLRLGHFR-VSILGLFDVTQMQYLQFLSALLSGLAFIAQYRMQVGNG 386
            |.|::...|.|:....: :...|:..:.......|:..|::.:.|:    :|:|.|
  Fly   331 QRTINRFLLQLQRSIDQPLEACGIVTLDTRSLGGFIGVLMAIVIFL----IQIGLG 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 71/375 (19%)
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 72/378 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.