DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr32a

DIOPT Version :8

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster

Alignment Length:404 Identity:75/405 (19%)
Similarity:148/405 (37%) Gaps:119/405 (29%)


  Fly    45 FIRNWLKWLNVTHRIITFT----RFFWVYIASISIKTNRVLQVLHGMRLVLSIPNVAVILCYHIF 105
            |:|..:..|.:.:....||    :.|:.|     .:|:.|.|.:..:..:|:. .:.|.:|.|  
  Fly    94 FVRGVVHALTIFNVYSLFTPISAQLFFSY-----RETDNVNQWIELLLCILTY-TLTVFVCAH-- 150

  Fly   106 RGPEIIDLINQFLRLFRQVSDLFKTK-TPGFGGRRELI---------LILLNLISFAHEQT---Y 157
            ....::.::|:.|:|..:|...|... :..||...:.:         :|:|.:.:...|.|   |
  Fly   151 NTTSMLRIMNEILQLDEEVRRQFGANLSQNFGFLVKFLVGITACQAYIIVLKIYAVQGEITPTSY 215

  Fly   158 L---WFTIRKGFSWRFLIDWWCDFYLVSATNIFIHINSIGYLSLGVLYSELNKYVYTNLRIQLQK 219
            :   ::.|:.|.:..:::     |.......::|..:.|..|        ||.|.|.    |..:
  Fly   216 ILLAFYGIQNGLTATYIV-----FASALLRIVYIRFHFINQL--------LNGYTYG----QQHR 263

  Fly   220 LNTSGSKQKIRR-----------VQNRLEKCISLYREIYHTSIMFHKLFVPLLFLALIYK----- 268
            ....|::.:.:|           :::..|..:.:||       |.:||.       .|||     
  Fly   264 RKEGGARARRQRGDVNPNVNPALMEHFPEDSLFIYR-------MHNKLL-------RIYKGINDC 314

  Fly   269 --VLLIALIGFNVAVEFY------LNSFI-----------------FWILLGKHVLDLFL----- 303
              ::|::.:|::    ||      .|.|:                 .|:.|  ||..|.|     
  Fly   315 CNLILVSFLGYS----FYTVTTNCYNLFVQITGKGMVSPNILQWCFAWLCL--HVSLLALLSRSC 373

  Fly   304 -VTVSVEGAVNQFLNIGMQFGNVGDLSK-FQTTLDTLFLHLRLGHFRVSILGLFDVTQMQYLQFL 366
             :|.:...|.:|.|      ..|...|| :|..:|...........:.:..|.|.:......:..
  Fly   374 GLTTTEANATSQIL------ARVYAKSKEYQNIIDKFLTKSIKQEVQFTAYGFFAIDNSTLFKIF 432

  Fly   367 SALLSGLAFIAQYR 380
            ||:.:.|..:.|::
  Fly   433 SAVTTYLVILIQFK 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 75/405 (19%)
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 75/405 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.