DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr8a

DIOPT Version :9

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster


Alignment Length:371 Identity:75/371 - (20%)
Similarity:121/371 - (32%) Gaps:128/371 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RVLQVL--HGMR--------------------LVLSIPNVAVILCYHIFRGPEIIDLINQFLRLF 121
            |:.|||  ||:.                    |::|: :..|:.|  :|.|.|.         |:
  Fly    14 RLYQVLGFHGLPLPGDGNPARTRRRLMAWSLFLLISL-SALVLAC--LFSGEEF---------LY 66

  Fly   122 RQVSDLFKTKTPG----FGGRRELILILLNLISFAHEQTYLWFTIRKG------FSWRFLIDWWC 176
            |  .|:|......    |.....|.:.|..|.|..|...:.|...:.|      .|.|.....:|
  Fly    67 R--GDMFGCANDALKYVFAELGVLAIYLETLSSQRHLANFWWLHFKLGGQKTGLVSLRSEFQQFC 129

  Fly   177 DF----YLVSATNIFIHINSIGYLSLG------------------------VLYSELNKYVYTNL 213
            .:    |.:.|..:.||:....:.:|.                        ||:.||.:...|.|
  Fly   130 RYLIFLYAMMAAEVAIHLGLWQFQALTQHMLLFWSTYEPLVWLTYLRNLQFVLHLELLREQLTGL 194

  Fly   214 RIQLQKL------------NTSGSKQKIRRVQNRLEKCISLYREIYHTSIMFHKLFVPLLFLALI 266
            ..::..|            :..|.:..:||   ||.:...:|..:|.....|...|        .
  Fly   195 EREMGLLAEYSRFASETGRSFPGFESFLRR---RLVQKQRIYSHVYDMLKCFQGAF--------N 248

  Fly   267 YKVLLIAL-IGFNVAVEFYLNSFIFWILLGKHV-LDLFLVT-----------------VSVEGAV 312
            :.:|.:.| |...:||:.|   |:::.:....: .|.:|:.                 |.|....
  Fly   249 FSILAVLLTINIRIAVDCY---FMYYSIYNNVINNDYYLIVPALLEIPAFIYASQSCMVVVPRIA 310

  Fly   313 NQFLNIGMQFG--NVGDLSKFQTTLDTLFLHLRLGH--FRVSILGL 354
            :|..||....|  :..|||     |......|:|.|  .|:..|||
  Fly   311 HQLHNIVTDSGCCSCPDLS-----LQIQNFSLQLLHQPIRIDCLGL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 75/371 (20%)
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 75/371 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.