DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr2a

DIOPT Version :8

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster

Alignment Length:104 Identity:30/105 (29%)
Similarity:43/105 (41%) Gaps:19/105 (18%)


  Fly     9 SAPKLSTSILRYIF--RYAQFIGVIFFCLHTRKDDKTVFIRNWLKWLNVTHRII--TFTRFFWVY 69
            |||.|...::..:.  |.||....:..|||    ..:|.:|      |.:|..:  |..|:....
  Fly   308 SAPHLGNVLVLSLLCDRTAQCASRLALCLH----QVSVDLR------NESHNALVGTLVRYCAPL 362

  Fly    70 IASISIK-TNRVLQVLHGMRLVLSIP---NVAVILCYHI 104
            |..:.:: |...||:|| .||..|..   ||...|.|.|
  Fly   363 IILVPLQITQFSLQLLH-QRLHFSAAGFFNVDCTLLYTI 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 26/96 (27%)
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 30/105 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.