DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and gur-3

DIOPT Version :8

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_509743.2 Gene:gur-3 / 181245 WormBaseID:WBGene00001804 Length:447 Species:Caenorhabditis elegans

Alignment Length:330 Identity:66/330 - (20%)
Similarity:112/330 - (33%) Gaps:106/330 - (32%)


  Fly    53 LNVTHRIITFTRFFW---VY----IASISIKT-NRVLQV-------------LHGMRLVLSIPNV 96
            ||.||.....|.|.|   :|    :|.::..| .|:.|:             .|    ||: |..
 Worm    58 LNHTHSSARNTMFKWPLTIYNYLTLAILTAATIRRISQIKQKSATNEEKDAAFH----VLN-PTF 117

  Fly    97 AVILCYHI--FRGPEIIDLINQFLRLFRQVSDLFKTKTPGFGGRR------------ELILIL-- 145
            .:.||:.:  |.|.....|:   |:|.:|...::.....|.|..|            :|.:.:  
 Worm   118 VLTLCHALLMFSGLAAGFLL---LKLQKQREKMYHVLDQGLGRNRNEEHDSHHFKLNKLFISISF 179

  Fly   146 -----LNLISFAHEQTYL-------------WFTIRKGFSWRFLIDWWCDFYLVSA-----TNIF 187
                 |:.:..|.:..||             :|.|.:|:.          .::.|:     ..:|
 Worm   180 SFAAALSFVQIATKMRYLDLPDTPDLINRKIYFVILEGYV----------IFIASSCISLVAILF 234

  Fly   188 IHINSIGYLSLGVLYSELNKYVYTNLRIQLQKLNTSGSKQKIRRVQNRLEKCISLYREIYHTSIM 252
            ..:..|...|:|.|..|:.........:..|.|      |:|..||..       |:||.:..:.
 Worm   235 FQLCRILQFSIGQLIEEMVPKEKEECPLPEQSL------QQIHDVQIH-------YQEISNAKLY 286

  Fly   253 FHKLFVPLLFLALIYKVLLIALIGF---------NVAVEFYLNSFIFWILLGKHVLDLFLV---T 305
            ..:.|...||......:.|..|:|:         ::|..|   |...|:......|.||.:   .
 Worm   287 IEQNFSFSLFYTYGCCIPLTCLLGYIAFRNGIQADMAETF---SVAIWLTNTMLALMLFSIPAFM 348

  Fly   306 VSVEG 310
            ::.||
 Worm   349 IAEEG 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 66/330 (20%)
gur-3NP_509743.2 7tm_7 46..425 CDD:285581 66/330 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.