DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr36a

DIOPT Version :8

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster

Alignment Length:402 Identity:77/403 (19%)
Similarity:163/403 (40%) Gaps:56/403 (14%)


  Fly    17 ILRYIFRYAQFIGVIFFCLHTRKDDKTVFIRNWLKWLNVTHRIITFTRFFWVYIASISIKTNRVL 81
            :|:.::.|.|.||:|.|.:..:: .:.|..:..:.:....:.:|..     |.:..||.|.|  |
  Fly     8 LLKVLYYYGQIIGLINFEIDWQR-GRVVAAQRGILFAIAINVLICM-----VLLLQISKKFN--L 64

  Fly    82 QVLHGMRLVLSIPNVAVILCYHIFRGPEIIDLIN------QFLRLFRQVSDLFKTKTPGFGGRRE 140
            .|..|....|....:.|::...:..|  |..::|      |.:||...|..||..|.......|.
  Fly    65 DVYFGRANQLHQYVIIVMVSLRMASG--ISAILNRWRQRAQLMRLVECVLRLFLKKPHVKQMSRW 127

  Fly   141 LIL------ILLNLISFAHEQTYLWFTIRKGFSWRFLIDWWCDFYLVSATNIFIHINSIGYLSLG 199
            .||      ::.|.:..|.....|   .|.||:  ..:....||::.:..|:.|..:.:..|.:.
  Fly   128 AILVKFSVGVVSNFLQMAISMESL---DRLGFN--EFVGMASDFWMSAIINMAISQHYLVILFVR 187

  Fly   200 VLY-------------SELNKYVYTNLRIQLQKLNTSGSK-QKIRRVQNRLEKCISLYREIYH-T 249
            ..|             |::...:|......:.|......: ..|.::||:|:..::...:::. .
  Fly   188 AYYHLLKTEVRQAIHESQMLSEIYPRRAAFMTKCCYLADRIDNIAKLQNQLQSIVTQLNQVFGIQ 252

  Fly   250 SIMFHKLFVPLLFLALIYKVLLIALIGFNVAVEFYLN----SFIF-WILL--GKHVLDLFLVTVS 307
            .||.:..:. :..:|..|....:|:.|..   |.:|:    :.:| |.|.  ...:|:||::...
  Fly   253 GIMVYGGYY-IFSVATTYITYSLAINGIE---ELHLSVRAAALVFSWFLFYYTSAILNLFVMLKL 313

  Fly   308 VEG--AVNQFLNIGMQFGNVGDLSKFQTTLDTLFLHLRLGHFRVSILGLFDVTQMQYLQFLSALL 370
            .:.  .:.:.|.....|.:..|: :.:.:.:::.|.|.....::.:|.:|.:|:......:.:::
  Fly   314 FDDHKEMERILEERTLFTSALDV-RLEQSFESIQLQLIRNPLKIEVLDIFTITRSSSAAMIGSII 377

  Fly   371 SGLAFIAQYRMQ 382
            :...|:.||.|:
  Fly   378 TNSIFLIQYDME 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 77/400 (19%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 77/402 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.