DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr93c

DIOPT Version :8

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_732665.1 Gene:Gr93c / 117471 FlyBaseID:FBgn0045469 Length:397 Species:Drosophila melanogaster

Alignment Length:404 Identity:127/405 (31%)
Similarity:199/405 (49%) Gaps:33/405 (8%)


  Fly     1 MFEFLHQMSAPKLSTSILRYIFRYAQFIGVIFFCLHTRKDDKTVFIRN--WLKWLNVTHRIITFT 63
            |.|.|.::|.|.||..||.....|.:.:|||.|.:..|..|.::.:||  ..||..::.|:|:.|
  Fly     1 MIERLKKVSLPALSAFILFCSCHYGRILGVICFDIGQRTSDDSLVVRNRHQFKWFCLSCRLISVT 65

  Fly    64 R---FFWVYIASISIKTNRVLQVLH-GMRLVLSIPNVAVILCYHIFRGPEIIDLINQFLRLFRQV 124
            .   |...|:|.|.....|:||... ...|:..|..:.|.:||.    .|::.:|..||||||:|
  Fly    66 AVCCFCAPYVADIEDPYERLLQCFRLSASLICGICIIVVQVCYE----KELLRMIISFLRLFRRV 126

  Fly   125 SDLFKTKTPGFGGRRELILILLNLISFAHEQTYLWFTIRKGFSWRF-----LIDWWCDFYLVSAT 184
            ..|...|..||||:||..|:|...|...:|   |:..|.:  .|..     |....|:.:|...:
  Fly   127 RRLSSLKRIGFGGKREFFLLLFKFICLVYE---LYSEICQ--LWHLPDSLSLFATLCEIFLEIGS 186

  Fly   185 NIFIHINSIGYLSLGVLYSELNKYVYTNLRIQLQKLNTS-----GSKQKIRRVQNRLEKCISLYR 244
            .:.|||..:||||:..||||:|.:....||.||:.|...     |.|| :|.|:.|:::|||:|.
  Fly   187 LMIIHIGFVGYLSVAALYSEVNSFARIELRRQLRSLERPVGGPVGRKQ-LRIVEYRVDECISVYD 250

  Fly   245 EIYHTSIMFHKLF-VPLLFLALIYKVLLIALIGFNVAV--EFYLNSFIFWILLGKHVLDLFLVTV 306
            ||......||:|. :|:|.: |:.|:....::.:.|.:  |.|......|.|:.|...|:.|:|:
  Fly   251 EIERVGRTFHRLLELPVLII-LLGKIFATTILSYEVIIRPELYARKIGMWGLVVKSFADVILLTL 314

  Fly   307 SVEGAVN---QFLNIGMQFGNVGDLSKFQTTLDTLFLHLRLGHFRVSILGLFDVTQMQYLQFLSA 368
            :|..||:   ....:.::...:.|...:....:.....|....|||..||||:|:....|.|||:
  Fly   315 AVHEAVSSSRMMRRLSLENFPITDHKAWHMKWEMFLSRLNFFEFRVRPLGLFEVSNEVILLFLSS 379

  Fly   369 LLSGLAFIAQYRMQ 382
            :::...::.||.:|
  Fly   380 MITYFTYVVQYGIQ 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 118/386 (31%)
Gr93cNP_732665.1 7tm_7 18..393 CDD:285581 118/386 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131233715
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.