DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr93d

DIOPT Version :8

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster

Alignment Length:405 Identity:126/406 (31%)
Similarity:203/406 (50%) Gaps:61/406 (15%)


  Fly     8 MSAPKLSTSILRYIFRYAQFIGVIFFCLHTRKDDKTVFIRNWL----------KWLNVTHRIITF 62
            |.|.|.|..|||::..||:|:.::.|.|..:||:..     ||          ||::||.||:..
  Fly     1 MKATKYSVGILRFMSFYARFLSLVCFRLRKQKDNNV-----WLEEIWSNRSRWKWISVTLRIVPL 60

  Fly    63 TRFFWVYIASISIKTNRVL---QVLHGMRLVLSIPNVAVILCYHIFRGPEIIDLINQFLRLFRQV 124
            ..:.:.|...||   ||:|   :.||...||:|||....|:...|..|||:..|:||:|.:|| :
  Fly    61 CIYAFTYAEWIS---NRMLITEKFLHSCSLVVSIPCYLSIIHLKICHGPEVTKLVNQYLHIFR-L 121

  Fly   125 SDLFKTKTPGFGGRRELILILLNLISFAHEQTYLWFTIRKGFSWRFLIDWWCDFYLVSATNIFIH 189
            ..|...:...|||.|||.|::|::....||..::.....:...::.:| ||     ||.|.:||.
  Fly   122 GTLDIRRRSQFGGGRELFLLILSVCCQIHEYVFILVIASRLCGFQHII-WW-----VSYTYVFII 180

  Fly   190 INS------IGYLSLGVLYSELNKYVYTNLRIQLQKLNTSGSKQKIRRVQNRL--EKCISLYREI 246
            .||      |.:|||||||:|||    .|||.:      ||.:....|.|.|:  :|.::|::||
  Fly   181 CNSIMCFGFIWHLSLGVLYAELN----DNLRFE------SGFQTAFLRKQQRIRVQKSMALFKEI 235

  Fly   247 YHTSIMFHKLFVPLLFLALIYKVLLIALIGFNVAVEFYLNSFIFWILLGKHVLDLFLVTVSVEGA 311
            .........:|...|||:.:..:|.:.::.:.:.::...:.|..|....|:::...|..::::.|
  Fly   236 SSVVTSLQDIFNVHLFLSALLTLLQVLVVWYKMIIDLGFSDFRIWSFSLKNLIQTLLPVLAIQEA 300

  Fly   312 VNQF-------LNIGMQFGNVGDLSKFQTTLDTLFLHLRLGHFRVSILGLFDVTQMQYLQFLSAL 369
            .|||       |:|.:    ||....:..:::....||.|..|||::||||:|:...:|..:||:
  Fly   301 ANQFKQTRERALDIFL----VGKSKHWMKSVEIFVTHLNLSEFRVNLLGLFNVSNELFLIIVSAM 361

  Fly   370 LSGLAFIAQ----YR 380
            ...|.|:.|    ||
  Fly   362 FCYLVFVTQCVIVYR 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 121/396 (31%)
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 119/393 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131233601
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.