DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr92a and Gr58a

DIOPT Version :9

Sequence 1:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_726135.2 Gene:Gr58a / 117344 FlyBaseID:FBgn0041239 Length:395 Species:Drosophila melanogaster


Alignment Length:399 Identity:69/399 - (17%)
Similarity:143/399 - (35%) Gaps:117/399 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 HTRKDDKTVFIRNWLKWLNVTHRIITFTRFFWVY--IASISIKTNRVLQVLHGMRLVLSIPNVAV 98
            |...||..:.....|||   |..:...||...::  :..:..:..|:|.:  |..|:|       
  Fly    55 HYMYDDSYMSSNPVLKW---TFNLTNITRIMAMFSGVLLMWFRRKRILNL--GENLIL------- 107

  Fly    99 ILCYHIFRGPEIIDLINQFLRLFRQVSD-LFKTKTPGFGGRRELILILLNLISFAHEQTYLWFTI 162
                |..:...:.:...::.:|.::|.: ||:            :|::.||              
  Fly   108 ----HCLKCKTLDNRSKKYSKLRKRVRNVLFQ------------MLLVANL-------------- 142

  Fly   163 RKGFSWRFLIDWWCDFYLVSATNIFIHINSIGYLS-LGVLYSELNKYVYT--------------- 211
                           ..|:.|..:| .|:|:..:| ..::.:.:.:::|.               
  Fly   143 ---------------SILLGALILF-RIHSVQRISKTAMIVAHITQFIYVVFMMTGICVILLVLH 191

  Fly   212 ----NLRIQLQKL----------NTSGSKQKIRRVQNRLEKCISLY-------REIYHT-----S 250
                .|:|.|:.|          :.:.|:.|..|...:|.|...|:       ||::.|     :
  Fly   192 WQSERLQIALKDLCSFLNHEERNSLTLSENKANRSLGKLAKLFKLFAENQRLVREVFRTFDLPIA 256

  Fly   251 IMFHKLFVPLLFLALIYKVLLIALIGFNVAVE--FYLNSFIFWILLGKHVLDLFLVTVSVEGAVN 313
            ::..|:||  ..:.|:|..:...    |..:|  .|......|:::..:...:.|:.|..:....
  Fly   257 LLLLKMFV--TNVNLVYHGVQFG----NDTIETSSYTRIVGQWVVISHYWSAVLLMNVVDDVTRR 315

  Fly   314 QFLNIG---MQFGNVGDLSK--FQTTLDTLFLHLRLGHFRVSILGLFDVTQMQYLQFLSALLSGL 373
            ..|.:|   .:|.:: :|.|  |...|:....|||.......:.|||...:...|.:...:|..:
  Fly   316 SDLKMGDLLREFSHL-ELVKRDFHLQLELFSDHLRCHPSTYKVCGLFIFNKQTSLAYFFYVLVQV 379

  Fly   374 AFIAQYRMQ 382
            ..:.|:.::
  Fly   380 LVLVQFDLK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 69/397 (17%)
Gr58aNP_726135.2 7tm_7 3..373 CDD:285581 67/382 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.