DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS14 and mrps14

DIOPT Version :8

Sequence 1:NP_001285438.1 Gene:mRpS14 / 117414 FlyBaseID:FBgn0044030 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001038823.1 Gene:mrps14 / 751639 ZFINID:ZDB-GENE-060825-75 Length:138 Species:Danio rerio

Alignment Length:127 Identity:70/128 (55%)
Similarity:93/128 (73%) Gaps:7/128 (5%)


  Fly     9 GFVCQSVQIA--GCG-----LQQVRTKYADWKMIRDVKRRKCVKENAVERLRVNSLRKNDILPPE 66
            ||:..|:..:  .|.     ::|||:.|.||:|:||||||:...|.|..|||:|::.||.|||.|
Zfish    12 GFLHSSLSFSRQACRSPVAVMEQVRSYYVDWRMLRDVKRRQMAFEYADTRLRINAIGKNTILPKE 76

  Fly    67 LREVADAEIAAFPRDSSLVRVRERCALTSRPRGVVHKYRLSRIVWRHLADYNKLSGVQRAMW 128
            |:|:||.||||.||||..||:|.||.||||||.|..::||||||:|.|||::::|||||:||
Zfish    77 LQEIADKEIAALPRDSCPVRIRNRCVLTSRPRAVKRRWRLSRIVFRDLADHSQMSGVQRSMW 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS14NP_001285438.1 Ribosomal_S14 36..128 CDD:294254 58/92 (63%)
mrps14NP_001038823.1 Ribosomal_S14 46..138 CDD:294254 58/92 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192500938
eggNOG 1 0.900 E1_COG0199
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H41467
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1612572at2759
OrthoFinder 1 1.000 FOG0004299
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127575
Panther 1 1.100 LDO PTHR19836
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.