DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS14 and Mrps14

DIOPT Version :8

Sequence 1:NP_001285438.1 Gene:mRpS14 / 117414 FlyBaseID:FBgn0044030 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_079750.1 Gene:Mrps14 / 64659 MGIID:1928141 Length:128 Species:Mus musculus

Alignment Length:116 Identity:73/117 (62%)
Similarity:89/117 (76%) Gaps:2/117 (2%)


  Fly    13 QSVQIAGCGLQQVRTKYADWKMIRDVKRRKCVKENAVERLRVNSLRKNDILPPELREVADAEIAA 77
            |:|..:..|  |||..|.||:|:||:||||...|.|.||||:||||||.|||.:|:|:|..||||
Mouse    15 QAVPPSASG--QVRGYYVDWRMLRDLKRRKMAYEYADERLRINSLRKNTILPKDLQEMAGDEIAA 77

  Fly    78 FPRDSSLVRVRERCALTSRPRGVVHKYRLSRIVWRHLADYNKLSGVQRAMW 128
            .||||..||:|.||.:|||||||..::||||||:|||||:..|||||||:|
Mouse    78 LPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGLLSGVQRAIW 128

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS14NP_001285438.1 Ribosomal_S14 36..128 CDD:294254 62/92 (67%)
Mrps14NP_079750.1 Ribosomal_S14 74..126 CDD:278673 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192498609
eggNOG 1 0.900 E1_COG0199
Hieranoid 1 1.000
Homologene 1 1.000 H41467
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004299
OrthoInspector 1 1.000 T1085143
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR19836
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1255
TreeFam 1 0.960
1110.840

Return to query results.
Submit another query.