DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS14 and MRPS14

DIOPT Version :8

Sequence 1:NP_001285438.1 Gene:mRpS14 / 117414 FlyBaseID:FBgn0044030 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_071383.1 Gene:MRPS14 / 63931 HGNCID:14049 Length:128 Species:Homo sapiens

Alignment Length:116 Identity:74/117 (63%)
Similarity:88/117 (75%) Gaps:2/117 (2%)


  Fly    13 QSVQIAGCGLQQVRTKYADWKMIRDVKRRKCVKENAVERLRVNSLRKNDILPPELREVADAEIAA 77
            |.|..:..|  |||:.|.||:|.|||||||...|.|.||||:||||||.|||..|::|||.||||
Human    15 QMVPSSASG--QVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAA 77

  Fly    78 FPRDSSLVRVRERCALTSRPRGVVHKYRLSRIVWRHLADYNKLSGVQRAMW 128
            .||||..||:|.||.:|||||||..::||||||:|||||:.:|||:|||.|
Human    78 LPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW 128

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS14NP_001285438.1 Ribosomal_S14 36..128 CDD:294254 63/92 (68%)
MRPS14NP_071383.1 Ribosomal_S14 74..126 CDD:306712 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192501412
eggNOG 1 0.900 E1_COG0199
Hieranoid 1 1.000
Homologene 1 1.000 H41467
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1612572at2759
OrthoFinder 1 1.000 FOG0004299
OrthoInspector 1 1.000 T1075040
orthoMCL 1 0.900 OOG5_127575
Panther 1 1.100 LDO PTHR19836
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1255
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.750

Return to query results.
Submit another query.