DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Chrnb1 and nAChRbeta1

Sequence 1:NP_033731.3 Gene:Chrnb1 MGIID:87890 Length:501 Species:Mus musculus
Sequence 2:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster

Alignment Length:501 Identity:191/502 (38%)
Similarity:290/502 (58%) Gaps:53/502 (11%)


Mouse    24 SEAEGQLIKKLFSNYDSSVRPAREVGDRVGVSIGLTLAQLISLNEKDEEMSTKVYLDLEWTDYRL 88
            ||.|.:|::.||..|:..:||.:.:..:|||..||...|||::|||::.|.:.|:|.|.|.||:|
  Fly    25 SEDEERLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEKNQIMKSNVWLRLVWYDYQL 89

Mouse    89 SWDPAEHDGIDSLRITAESVWLPDVVLLNNNDGNFDVALDINVVVSFEGSVRWQPPGLYRSSCSI 153
            .||.|::.||..||:..:.||.||:||.||.|||::|....||::...|.|.|.||.:|:|||:|
  Fly    90 QWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIYPTGEVLWVPPAIYQSSCTI 154

Mouse   154 QVTYFPFDWQNCTMVFSSYSYDSSEVSLKTGLDPEGEERQEVYIHEGTFIENGQWEIIHKPSRLI 218
            .|||||||.|.|.|.|.|::::..:|||..       ...:.::....:.::|.|:||..|:.|.
  Fly   155 DVTYFPFDQQTCIMKFGSWTFNGDQVSLAL-------YNNKNFVDLSDYWKSGTWDIIEVPAYLN 212

Mouse   219 QLPGDQRGGKEGHHEEVIFYLIIRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFA 283
            ...||.....|   .::.||:|||||.|||.||:|.|.:||:.|.:.|||||.:||||:.|.|..
  Fly   213 VYEGDSNHPTE---TDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEAGEKVTLGISI 274

Mouse   284 LLTLTVFLLLLADKVPETSLAVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPFWVRQ 348
            ||:|.|||||::..:|.|||.:|:|.|||:||.::.|.|::::|:::|.:.|.|.||:||.::|.
  Fly   275 LLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPRTHRMPMYIRS 339

Mouse   349 IFIHKLPPYLGLKRPKPER----DQLP------EPHHSL-SPR------SGWGRGTDEYFIRKPP 396
            ||:|.||.:|.:|||:..|    .::|      .||.|. ||.      |..| |..........
  Fly   340 IFLHYLPAFLFMKRPRKTRLRWMMEMPGMSMPAHPHPSYGSPAELPKHISAIG-GKQSKMEVMEL 403

Mouse   397 SDFLFP--KLNR-------------FQPESSAPDLRRFIDGPTRAVGLPQELREVISSISYMARQ 446
            ||...|  |:||             .:.||.:.|          ::.|..|..:...::.::|..
  Fly   404 SDLHHPNCKINRKVNSGGELGLGDGCRRESESSD----------SILLSPEASKATEAVEFIAEH 458

Mouse   447 LQEQEDHDALKEDWQFVAMVVDRLFLWTFIVFTSVGTLVIFLDATY 492
            |:.::.:...:|||::||||:|||.|:.|.:.|:.||:.|.:||.:
  Fly   459 LRNEDLYIQTREDWKYVAMVIDRLQLYIFFIVTTAGTVGILMDAPH 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Chrnb1NP_033731.3 LIC 24..488 CDD:273305 189/496 (38%)
Neur_chan_LBD 27..245 CDD:280998 88/218 (40%)
Neur_chan_memb 252..487 CDD:280999 94/267 (35%)
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 189/496 (38%)
Neur_chan_LBD 28..236 CDD:280998 88/218 (40%)
Neur_chan_memb 243..498 CDD:280999 93/266 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4377
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.790 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.820

Return to query results.
Submit another query.