DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHRNB2 and NtR

Sequence 1:NP_000739.1 Gene:CHRNB2 HGNCID:1962 Length:502 Species:Homo sapiens
Sequence 2:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster

Alignment Length:380 Identity:87/381 (23%)
Similarity:147/381 (39%) Gaps:79/381 (21%)


Human    29 EERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLT 93
            ||...|.||  |..|.....|:..:.|.::........| :..:...::.|.:.:...|.|.||.
  Fly   212 EETKTEKLL--SHLNIQAENASMPANLSSISFHFQTRSL-AYEQTSSLLQTRMHMMMHWRDSRLV 273

Human    94 WKPEEFDNMKKVRLPSKHIWLPDVVLYNNA-DGM------YEVSFYSNAVVSYDGSIFWLPPAIY 151
            ||||:|.:::....|...||.|.:.:.|.| ..|      ||:..|:|      |||     .:|
  Fly   274 WKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYAN------GSI-----TLY 327

Human   152 KSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVL-------KSEVASLDD------------F 197
              |..:::..:      |....|:|..:|...|:.|       :..||.:.|            .
  Fly   328 --AQNLQLASW------CVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVN 384

Human   198 TPSGEWD-------IVALPGRRNENPD---DSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLA 252
            |||| |.       :|....:|..||.   .....|:..:|.::|...||.....:|.:......
  Fly   385 TPSG-WSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFL 448

Human   253 ILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVC 317
            ||.|.|.|.  .:.:|.:..||.....|:.:::...|..:. |::..|.:. |:..|:..:..:|
  Fly   449 ILSFVLRST--RRSSLILIALLIAAWGLMYMTRYASPHYVP-PMMTAYKVI-MMTTTYCYILHIC 509

Human   318 VLNVHHRSPTTHTMAP-W-VKVVFLEKLPALL------------FMQQPRHHCAR 358
            ::.:....|  .:.|| | |:|:....|..:|            ..:.|.||.|:
  Fly   510 IIWLDLYPP--RSKAPGWLVRVINSNVLRCILGLRFSDSTDYCDIQENPWHHMAK 562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHRNB2NP_000739.1 Neur_chan_LBD 29..234 CDD:308532 57/241 (24%)
Neur_chan_memb 241..478 CDD:308533 28/133 (21%)
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 57/240 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.