DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHRNB2 and nAChRbeta2

Sequence 1:NP_000739.1 Gene:CHRNB2 HGNCID:1962 Length:502 Species:Homo sapiens
Sequence 2:NP_524483.1 Gene:nAChRbeta2 FlyBaseID:FBgn0004118 Length:519 Species:Drosophila melanogaster

Alignment Length:487 Identity:212/488 (43%)
Similarity:301/488 (62%) Gaps:66/488 (14%)


Human    27 DTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYR 91
            || :||.:.||  |.||:||||..|.:|.:||.|.:.|:|||.|:.:.|:||||:|:.|.|.||:
  Fly    29 DT-KRLYDDLL--SNYNRLIRPVVNNTETLTVWLGLKLSQLIEVNLKNQVMTTNLWVKQRWFDYK 90

Human    92 LTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACK 156
            |.|.|||:..::::.:||:|||:||:|||||.||.|||:..:.|.:.|.|.:||.|||||||:|:
  Fly    91 LRWDPEEYGGVEQLYVPSEHIWVPDIVLYNNWDGNYEVTLMTKATLKYTGEVFWEPPAIYKSSCE 155

Human   157 IEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEV---------ASLDDFTPSGEWDIVALPGRR 212
            :.|::||:|:|.|.|||.||||:..::||....::         ..|.:|..|.||||:.:|..:
  Fly   156 MNVEYFPYDEQICFMKFGSWTYNGAQVDLKHLDQIPGSNLVQVGIDLTEFYLSVEWDILEVPATK 220

Human   213 NEN--PDD-STYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLL 274
            ||.  ||. ..:.|||:...:|||.||||:|||:|||.:|.|.:||||||||.|||:|||||:|:
  Fly   221 NEEYYPDTLEPFSDITFKLTMRRKTLFYTVNLIVPCVALTFLTVLVFYLPSDSGEKVTLCISILV 285

Human   275 ALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVF 339
            :||||.||:::|:|||||.|||:||||:|||:||:.|:.|:|||||:|.|||:||.|:|.|:.:|
  Fly   286 SLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMILVSLSVWTTVCVLNIHFRSPSTHNMSPLVRKLF 350

Human   340 LEKLPALLFMQQPRHHCARQRLRLRRRQREREGAGALFFREAPGADSCT---CFVNRASVQGLAG 401
            |..:|.|:.|::.::                         ..|..|..|   .:.|...|:....
  Fly   351 LHFMPKLMMMRRTQY-------------------------TLPDYDDSTPSNGYTNEIDVRDSIS 390

Human   402 AFGAEPAPVAGPGRSGEPCGCGLREAVD------------------GVRFIADHMRSEDDDQSVS 448
            .|.:|...........     |::.:||                  .|||||.|::..|.|..:.
  Fly   391 DFPSEFKDSQDGAYDN-----GMQNSVDSDNVIPRNLTPEVLQALRAVRFIAQHIKDADKDNEIV 450

Human   449 EDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ 480
            ||||:|:||:||.|||:|...|||||:.:..|
  Fly   451 EDWKFVSMVLDRFFLWLFTLSCVFGTLAIICQ 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHRNB2NP_000739.1 Neur_chan_LBD 29..234 CDD:308532 99/217 (46%)
Neur_chan_memb 241..478 CDD:308533 105/258 (41%)
nAChRbeta2NP_524483.1 LIC 9..479 CDD:273305 211/483 (44%)
Neur_chan_LBD 31..245 CDD:280998 99/216 (46%)
Neur_chan_memb 252..479 CDD:280999 105/257 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.