DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHRNB2 and nAChRalpha2

Sequence 1:NP_000739.1 Gene:CHRNB2 HGNCID:1962 Length:502 Species:Homo sapiens
Sequence 2:NP_524482.1 Gene:nAChRalpha2 FlyBaseID:FBgn0000039 Length:576 Species:Drosophila melanogaster

Alignment Length:540 Identity:225/541 (42%)
Similarity:320/541 (59%) Gaps:88/541 (16%)


Human     3 RRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQL 67
            |.|.|:.|||  .||.||..|......:||.:.||  |.||:||||.:|.::.|.|:|.:.|:||
  Fly    21 RHCKPLCLLL--VLLLLCETVQANPDAKRLYDDLL--SNYNRLIRPVSNNTDTVLVKLGLRLSQL 81

Human    68 ISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFY 132
            |.::.::||:||||||..||:|::..|.|.|:..:.::.:||:||||||:||||||||.|.|:..
  Fly    82 IDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTM 146

Human   133 SNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLV---------LK 188
            :.|::.|.|.:.|.||||:||:|:|:|::||||||.|.|||.|||||..:|||.         .|
  Fly   147 TKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNK 211

Human   189 SEVA-SLDDFTPSGEWDIVALPGRRNE-------NPDDSTYVDITYDFIIRRKPLFYTINLIIPC 245
            .|:. .|.::.||.||||:.:|..|:|       .|    |.||.::..:|||.||||:||||||
  Fly   212 VEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEP----YPDIFFNITLRRKTLFYTVNLIIPC 272

Human   246 VLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTF 310
            |.|:.|::||||||:|.|||:.||||:||:.|:|.||||:|:|.|||.:||:||||:|||:||..
  Fly   273 VGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGL 337

Human   311 SIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPR---HHCARQRLRL--------- 363
            |:|.::.:||:|:|.|:||.|.||::..|:::||.||.|:.|:   ...|..::..         
  Fly   338 SVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMRVPKDLLRDLAANKINYGLKFSKTKF 402

Human   364 -------------------RRRQREREGAGALFFREAPGADS--CTCFVNRASVQGLAGAFGAEP 407
                               .||.:.|.|||        |.:.  .|...||.|  ||.||.|...
  Fly   403 GQALMDEMQMNSGGSSPDSLRRMQGRVGAG--------GCNGMHVTTATNRFS--GLVGALGGGL 457

Human   408 APVAGPGRSGEPCGCG------------------LREAVDGVRFIADHMRSEDDDQSVSEDWKYV 454
            :.::  |.:|.|....                  |.:|:..|.||..||:.:|:..:..:||.:|
  Fly   458 STLS--GYNGLPSVLSGLDDSLSDVAARKKYPFELEKAIHNVMFIQHHMQRQDEFNAEDQDWGFV 520

Human   455 AMVIDRLFLWIFVFVCVFGT 474
            |||:||||||:|:...:.||
  Fly   521 AMVMDRLFLWLFMIASLVGT 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHRNB2NP_000739.1 Neur_chan_LBD 29..234 CDD:308532 101/222 (45%)
Neur_chan_memb 241..478 CDD:308533 108/286 (38%)
nAChRalpha2NP_524482.1 Neur_chan_LBD 45..261 CDD:280998 101/222 (45%)
LIC 47..544 CDD:273305 214/513 (42%)
Neur_chan_memb 268..543 CDD:280999 108/286 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.