DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHRNB2 and nAChRalpha1

Sequence 1:NP_000739.1 Gene:CHRNB2 HGNCID:1962 Length:502 Species:Homo sapiens
Sequence 2:NP_001262916.1 Gene:nAChRalpha1 FlyBaseID:FBgn0000036 Length:597 Species:Drosophila melanogaster

Alignment Length:534 Identity:233/535 (44%)
Similarity:322/535 (60%) Gaps:61/535 (11%)


Human     6 GPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV 70
            |.|.....|..|...:|.......:||.:.||  |.||:||||..|.|:.:||::.:.|:|||.|
  Fly     2 GSVLFAAVFIALHFATGGLANPDAKRLYDDLL--SNYNRLIRPVGNNSDRLTVKMGLRLSQLIDV 64

Human    71 HEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNA 135
            :.:.||||||||:.|||.||:|.|.|:::..:..:.:||:||||||:||||||||.|||:..:.|
  Fly    65 NLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLYNNADGNYEVTIMTKA 129

Human   136 VVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVA-------- 192
            ::.:.|.:.|.|||||||.|:|:|::||||:|.|.|||.|||||...:||....:.|        
  Fly   130 ILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQTADSDNIEVG 194

Human   193 -SLDDFTPSGEWDIVALPGRRNE---NPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAI 253
             .|.|:..|.||||:.:|..|||   :..:..|:||.::..:|||.||||:|||||||.|:.|::
  Fly   195 IDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSV 259

Human   254 LVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCV 318
            ||||||||.|||::||||:||:||||.||:::|:|||||.|||:||||:|||:|||.|:|.::.|
  Fly   260 LVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAV 324

Human   319 LNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPR----------------HHCARQRLRLRRRQ 367
            |||:.|||.||.|||||:.:|::.||.||.:::|:                :|......:.....
  Fly   325 LNVNFRSPVTHRMAPWVQRLFIQILPKLLCIERPKKEEPEEDQPPEVLTDVYHLPPDVDKFVNYD 389

Human   368 RER----EGAGAL-----FFREAPGADSCTCFV---------------NRASVQGLAGAFGAEPA 408
            .:|    .|..||     |...|.|..|..||.               :..|..||.|.......
  Fly   390 SKRFSGDYGIPALPASHRFDLAAAGGISAHCFAEPPLPSSLPLPGADDDLFSPSGLNGDISPGCC 454

Human   409 PVAGPGRSGE-------PCGCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIF 466
            |.|....:.:       |....:.:.::|.||||.|::::|..:||.|||||||||:||:|||||
  Fly   455 PAAAAAAAADLSPTFEKPYAREMEKTIEGSRFIAQHVKNKDKFESVEEDWKYVAMVLDRMFLWIF 519

Human   467 VFVCVFGTIGMFLQ 480
            ...||.||..:.||
  Fly   520 AIACVVGTALIILQ 533

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHRNB2NP_000739.1 Neur_chan_LBD 29..234 CDD:308532 102/217 (47%)
Neur_chan_memb 241..478 CDD:308533 119/284 (42%)
nAChRalpha1NP_001262916.1 Neur_chan_LBD 25..240 CDD:280998 102/217 (47%)
LIC 27..530 CDD:273305 226/505 (45%)
Neur_chan_memb 247..530 CDD:280999 119/283 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H595
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.