DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHRNB2 and nAChRalpha4

Sequence 1:NP_000739.1 Gene:CHRNB2 HGNCID:1962 Length:502 Species:Homo sapiens
Sequence 2:NP_001097669.2 Gene:nAChRalpha4 FlyBaseID:FBgn0266347 Length:539 Species:Drosophila melanogaster

Alignment Length:505 Identity:221/506 (44%)
Similarity:305/506 (60%) Gaps:49/506 (10%)


Human    23 VWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEW 87
            |.|....:||.:.||  |.||||:||..|.::::.|.:.:.|:|||.|:.:.||||||:|:.|.|
  Fly     6 VAGNPDAKRLYDDLL--SNYNKLVRPVVNTTDVLKVCIKLKLSQLIDVNLKNQIMTTNLWVEQSW 68

Human    88 EDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYK 152
            .||:|.|:|:|:..:..:.:||.|||.||:||||||||.:||:..:.|.:..:|.:.|.||||||
  Fly    69 YDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATIYSEGLVEWKPPAIYK 133

Human   153 SACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSE------VA---SLDDFTPSGEWDIVAL 208
            |:|:|:|::||||:|.|.:||.|||||..::||....|      ||   .|.:|..|.||||:.:
  Fly   134 SSCEIDVEYFPFDEQTCVLKFGSWTYDGFKVDLRHMDEQQGSNVVAVGVDLSEFYMSVEWDILEV 198

Human   209 PGRRNE---NPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCI 270
            |..|||   ...|..|:|||::..:|||.||||:|:||||:.|:.|.:|.||||||.|||:||.|
  Fly   199 PAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSI 263

Human   271 SVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWV 335
            |:|::|.||.||:.:|:|||||.|||:||||:|.|:||:.||..:|.|||||.|||.||.|||||
  Fly   264 SILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVLNVHFRSPQTHKMAPWV 328

Human   336 KVVFLEKLPALLFMQQPRHHCARQRLRLR-----------------------RRQREREGAGALF 377
            |.||::.|||.||:::|.::....:|.|:                       .....:|......
  Fly   329 KRVFIDFLPAFLFIKRPTYNFETSKLLLKDTHACFYPYYSATNIDRLVSSGYNNSLPKEDLSQSI 393

Human   378 FREAPGADSCTCF-----VNRASVQGLA-------GAFGAEPAPVAGPGRSGEPCGCGLREAVDG 430
            ....|...||...     :...|...:|       |..|.:...:..|..|...|...:.::...
  Fly   394 TANGPFGGSCQVHGPVPPLTHCSSDEIAAVPDMDIGPLGMKSPILNNPAFSHSKCLPKIHKSCFC 458

Human   431 VRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ 480
            |||||:|.:.::|...|.|||||||||:||||||||....|.||.|:.||
  Fly   459 VRFIAEHTKMQEDSTKVKEDWKYVAMVLDRLFLWIFTLAVVVGTAGIILQ 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHRNB2NP_000739.1 Neur_chan_LBD 29..234 CDD:308532 100/217 (46%)
Neur_chan_memb 241..478 CDD:308533 112/272 (41%)
nAChRalpha4NP_001097669.2 LIC 1..505 CDD:273305 219/501 (44%)
Neur_chan_LBD 12..227 CDD:280998 100/217 (46%)
Neur_chan_memb 234..505 CDD:280999 112/271 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.