DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHRNB2 and nAChRbeta1

Sequence 1:NP_000739.1 Gene:CHRNB2 HGNCID:1962 Length:502 Species:Homo sapiens
Sequence 2:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster

Alignment Length:515 Identity:215/516 (42%)
Similarity:296/516 (57%) Gaps:70/516 (14%)


Human     8 VALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHE 72
            :.:|:.|.|      |..::.|||||..|.  ..|||||||..|.::.|.|:..::..|||:|:|
  Fly    13 ILVLVAFSL------VSASEDEERLVRDLF--RGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNE 69

Human    73 REQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVV 137
            :.|||.:||||...|.||:|.|...::..:..:|||...:|.||:||:|||||.|||.:.||.::
  Fly    70 KNQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLI 134

Human   138 SYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVL--KSEVASLDDFTPS 200
            ...|.:.|:|||||:|:|.|:|.:||||||.|.|||.|||::..::.|.|  ......|.|:..|
  Fly   135 YPTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDLSDYWKS 199

Human   201 GEWDIVALPGRRNENPDDS---TYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDC 262
            |.|||:.:|...|....||   |..|||:..|||||.||||:|||:|.|||:.|.:||||||::.
  Fly   200 GTWDIIEVPAYLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEA 264

Human   263 GEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPT 327
            |||:||.||:||:|.|||||:|||:|||||.:||:.|||:||.::.|.||:.:|.::|.:.|.|.
  Fly   265 GEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPR 329

Human   328 THTMAPWVKVVFLEKLPALLFMQQPRHHCARQRLRLRRRQREREGAGALFFREAPG----ADSCT 388
            ||.|..:::.:||..|||.|||::||      :.|||            :..|.||    |....
  Fly   330 THRMPMYIRSIFLHYLPAFLFMKRPR------KTRLR------------WMMEMPGMSMPAHPHP 376

Human   389 CFVNRASVQGLAGAFGAEPA-------------------PVAGPGRSGEPCGCGLRE-------- 426
            .:.:.|.:.....|.|.:.:                   .|...|..|...|| .||        
  Fly   377 SYGSPAELPKHISAIGGKQSKMEVMELSDLHHPNCKINRKVNSGGELGLGDGC-RRESESSDSIL 440

Human   427 -------AVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFL 479
                   |.:.|.|||:|:|:||......|||||||||||||.|:||..|...||:|:.:
  Fly   441 LSPEASKATEAVEFIAEHLRNEDLYIQTREDWKYVAMVIDRLQLYIFFIVTTAGTVGILM 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHRNB2NP_000739.1 Neur_chan_LBD 29..234 CDD:308532 97/210 (46%)
Neur_chan_memb 241..478 CDD:308533 109/275 (40%)
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 215/514 (42%)
Neur_chan_LBD 28..236 CDD:280998 97/210 (46%)
Neur_chan_memb 243..498 CDD:280999 109/274 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.787 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.