DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHRNB2 and nAChRbeta3

Sequence 1:NP_000739.1 Gene:CHRNB2 HGNCID:1962 Length:502 Species:Homo sapiens
Sequence 2:NP_525098.1 Gene:nAChRbeta3 FlyBaseID:FBgn0031261 Length:441 Species:Drosophila melanogaster

Alignment Length:513 Identity:118/514 (23%)
Similarity:205/514 (40%) Gaps:135/514 (26%)


Human     6 GP-----VALLLGFGLLRLCSGVWGTDTE----------ERLVEHLLDPSRYNKLIRPATNGSEL 55
            ||     :.:|:|..|:.|.|....|.|.          :||...|.  :.|:..::|...|:..
  Fly    13 GPGLPLLLQMLMGMLLMGLTSVPGATATADPKNANVKALDRLHAGLF--TNYDSDVQPVFQGTPT 75

Human    56 -VTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVL 119
             |:::::|:   .|.:.|....:||:.||...|.|....|:|.::||:.::.|.|..:|.|.:.|
  Fly    76 NVSLEMVVT---YIDIDELNGKLTTHCWLNLRWRDEERVWQPSQYDNITQITLKSSEVWTPQITL 137

Human   120 YNNADG--MYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTE 182
            :|..:|  |.|    :...:|:||...|:|||:|.:.|::.:.::|.|:|:|.:|..||     .
  Fly   138 FNGDEGGLMAE----TQVTLSHDGHFRWMPPAVYTAYCELNMLNWPHDKQSCKLKIGSW-----G 193

Human   183 IDLVL------KSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINL 241
            :.:||      :.|....||...|.||:||   ..|........|..:.|....:|:...||..:
  Fly   194 LKVVLPENGTARGESLDHDDLVQSPEWEIV---DSRAHFVSQDYYGYMEYTLTAQRRSSMYTAVI 255

Human   242 IIPCVLITSLAILVFYLPSDC-GEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTM 305
            ..|...|..||:..|:||... |||:.:...:::.:..||:..::::|..|.:.|||  .:.::.
  Fly   256 YTPASCIVILALSAFWLPPHMGGEKIMINGLLIIVIAAFLMYFAQLLPVLSNNTPLV--VIFYST 318

Human   306 VLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQRL--RLRRRQR 368
            .|:..|:.|.|.||                          :|::...:|   ::||  .||:...
  Fly   319 SLLYLSVSTIVEVL--------------------------VLYLATGKH---KRRLPEALRKLLH 354

Human   369 EREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPCGCGLREAVDGVRF 433
            ...|...|.                 ||....|...||.                       .:.
  Fly   355 GHLGTWLLL-----------------SVFSTTGESQAEK-----------------------TKE 379

Human   434 IADHMRSEDDDQSVSE----------------DWKYVAMVIDRL----FLWIFVFVCV 471
            :.:|...|.|:|..|.                ||..:|..:||:    |...|:.:.:
  Fly   380 MDEHPYEEADEQESSPLGINHTEVPGAKANQFDWALLATAVDRISFVSFSLAFLILAI 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHRNB2NP_000739.1 Neur_chan_LBD 29..234 CDD:308532 59/224 (26%)
Neur_chan_memb 241..478 CDD:308533 48/255 (19%)
nAChRbeta3NP_525098.1 LIC 39..437 CDD:273305 110/486 (23%)
Neur_chan_LBD 52..247 CDD:280998 59/212 (28%)
Neur_chan_memb 255..434 CDD:280999 48/250 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.