DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHRNB2 and nAChRalpha3

Sequence 1:NP_000739.1 Gene:CHRNB2 HGNCID:1962 Length:502 Species:Homo sapiens
Sequence 2:NP_001285015.1 Gene:nAChRalpha3 FlyBaseID:FBgn0015519 Length:795 Species:Drosophila melanogaster

Alignment Length:760 Identity:244/761 (32%)
Similarity:331/761 (43%) Gaps:297/761 (39%)


Human    10 LLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHERE 74
            |:|.|    :.|.....|. :||.:.||  |.||||:||..|.::.:||::.:.|:|||.|:.:.
  Fly    12 LVLSF----ISSSTANPDA-KRLYDDLL--SNYNKLVRPVVNVTDALTVRIKLKLSQLIDVNLKN 69

Human    75 QIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSY 139
            ||||||:|:.|.|.||:|.|:|:|:..::.:.:||.|||.||:||||||||.:||:..:.|.::|
  Fly    70 QIMTTNLWVEQSWYDYKLKWEPKEYGGVEMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATLNY 134

Human   140 DGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEV---------ASLD 195
            .|.:.|.|||||||:|:|:|::||||:|.|.|||.|||||..::||....|:         ..|.
  Fly   135 TGRVEWRPPAIYKSSCEIDVEYFPFDEQTCVMKFGSWTYDGFQVDLRHIDELNGTNVVEVGVDLS 199

Human   196 DFTPSGEWDIVALPGRRNE---NPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFY 257
            :|..|.||||:.:|..|||   ...|..|:|||::..:|||.||||:||||||:.|:.|.|||||
  Fly   200 EFYTSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMGISFLTILVFY 264

Human   258 LPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVH 322
            ||||.|||::|.||:||:||||.||:::|:|||||.|||:||:::|||:|.||||..:|.|||:|
  Fly   265 LPSDSGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICVTVLVLNIH 329

Human   323 HRSPTTHTMAPWVKVVFLEKLPALLFMQQP----------------------------------- 352
            .|||.||||||||:.||:.:||..|.|::|                                   
  Fly   330 FRSPQTHTMAPWVRTVFINQLPRFLVMRRPLYPISEMIKSSRRLMVRTCNGLELRDQIPPLPPPV 394

Human   353 ----RHHCARQRLR-----LRRR------------------------------------------ 366
                .||..:...|     |:.|                                          
  Fly   395 ALSRMHHSPKTTSRSTSPHLQHRVQTYNLMDECGMGMGGGASTITGHLSSLYPPTMSTANQQTST 459

Human   367 -----------QREREGAGALF--------FREAPG----------------------------- 383
                       |.::.| |:|.        ||:...                             
  Fly   460 TSSLIDAQYHNQYQQTG-GSLLDHPLTPTKFRQMTSTSSQTGQNGSGNGNGNGGYGGHGQSGGHH 523

Human   384 ------------------------------------------------------ADSC---TCFV 391
                                                                  ||||   |..:
  Fly   524 LYRQQSSCSANFSPLPQHAHQAHASTTTSDLGMANPNVIKSTTTVNSVATASTLADSCCSGTIQI 588

Human   392 NR--------------------------------------------------------------- 393
            ::                                                               
  Fly   589 HQGMGAGAACQSSELLHHQQLHHQQMHHQQQQQQQQQHHHHQRPTTSAAAAAAAAAAGGPSTSAA 653

Human   394 ASVQGLAGAFGAEPAPVAGPG---------RSGEPCGCG--------------LREAVDGVRFIA 435
            |:....|.|.|..|.|....|         |.|.|..|.              |.:|:|||.:||
  Fly   654 AAAAAAAAAAGTPPPPPPPAGVCDILPACQREGGPHCCSGRGNVRQRWHTCPELHKAMDGVTYIA 718

Human   436 DHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ 480
            |..|.|::...|.|||||||||:||||||||....|.||.|:.||
  Fly   719 DQTRKEEESTRVKEDWKYVAMVLDRLFLWIFTIAVVVGTAGIILQ 763

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHRNB2NP_000739.1 Neur_chan_LBD 29..234 CDD:308532 101/217 (47%)
Neur_chan_memb 241..478 CDD:308533 131/514 (25%)
nAChRalpha3NP_001285015.1 Neur_chan_LBD 26..241 CDD:280998 101/218 (46%)
Neur_chan_memb 248..>359 CDD:280999 71/111 (64%)
Neur_chan_memb <683..760 CDD:280999 36/77 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.