DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STK38 and wts

DIOPT Version :9

Sequence 1:NP_001292031.1 Gene:STK38 / 11329 HGNCID:17847 Length:465 Species:Homo sapiens
Sequence 2:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster


Alignment Length:490 Identity:211/490 - (43%)
Similarity:299/490 - (61%) Gaps:54/490 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     4 TGSTPCSSMS----NHTK---ERVTMT--------------------KVTLENFYSNLIAQHEER 41
            ||:|..||.|    .|..   ||..::                    |..:|....|:|..:.:|
  Fly   607 TGTTASSSTSCKKIKHASPIPERKKISKEKEEERKEFRIRQYSPQAFKFFMEQHIENVIKSYRQR 671

Human    42 EMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLV 106
            ..|:.:|||.|.:.||.|:.:...|....:||:.::||||.::....|..||.||.||||||.||
  Fly   672 TYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLV 736

Human   107 QKKDT-GHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLP 170
            .|.|| .|:||||.|||||:|::.||.|::||||||.|||:.||||::||||||.|||.:|:::|
  Fly   737 SKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKLYYSFQDKDNLYFVMDYIP 801

Human   171 GGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCT 235
            |||:|:||:|.....||..:|||||...|:||:|::|||||||||||:|:|..||:||:||||||
  Fly   802 GGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCT 866

Human   236 GLKKAHRTEFYR-NLNHSLPSDFTFQNMNSKRKAETWKRN---------------RRQLAFSTVG 284
            |.:..|.:::|: |.|||        ..:|....|.:..|               :|.||.|.||
  Fly   867 GFRWTHNSKYYQENGNHS--------RQDSMEPWEEYSENGPKPTVLERRRMRDHQRVLAHSLVG 923

Human   285 TPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPI 349
            ||:||||||..::||.:|||:||:|||:||||:|.|||.:.:|.||.:||:||::||..||:..:
  Fly   924 TPNYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAEL 988

Human   350 SEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFP 414
            |.:|.|||.|.|...:.|:| ..|:|:||:.||:|:|:..:|::.|....|||...||||||...
  Fly   989 SREATDLIRRLCASADKRLG-KSVDEVKSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVD 1052

Human   415 ESDILKPTVATSNHPETDYKNKDW-VFINYTYKRF 448
            ...:.......|:..:.|..::.: .|..:|::||
  Fly  1053 PEKLRSNDSTMSSGDDVDQNDRTFHGFFEFTFRRF 1087

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STK38NP_001292031.1 Interaction with S100B. /evidence=ECO:0000269|PubMed:14661952 62..87 7/24 (29%)
STKc_NDR1 87..462 CDD:270777 182/380 (48%)
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 178/369 (48%)
S_TKc 719..1020 CDD:214567 161/309 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D216969at33208
OrthoFinder 1 1.000 - - FOG0000273
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.