DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GPN1 and CG3704

Sequence 1:NP_009197.3 Gene:GPN1 HGNCID:17030 Length:374 Species:Homo sapiens
Sequence 2:NP_569872.1 Gene:CG3704 FlyBaseID:FBgn0040346 Length:382 Species:Drosophila melanogaster

Alignment Length:387 Identity:187/388 (48%)
Similarity:251/388 (65%) Gaps:31/388 (8%)


Human     1 MAASAAAAELQA---SGGPRH-PVCLLVLGMAGSGKTTFVQRLTGHLHAQGTPPYVINLDPAVHE 61
            ||....:.:|:|   |.|.|. |||:|||||||||||||.|:|..|...:.. |||:|||||..|
  Fly     1 MAEGVESIKLEALSLSEGIRESPVCILVLGMAGSGKTTFTQKLIQHAQEKFN-PYVVNLDPACRE 64

Human    62 VPFPANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKA-QNMSKYVLIDTPG 125
            ||:.|::||||||.|:||||||.|||||||||:||:|.|:..|..:.:.:| :...|:.:|||||
  Fly    65 VPYAAHVDIRDTVNYREVMKQYQLGPNGGIVTALNMFTTKMAQFAELVRRAGERGHKWCVIDTPG 129

Human   126 QIEVFTWSASGTIITEALASSFPTVVIYVMDTSRSTNPVTFMSNMLYACSILYKTKLPFIVVMNK 190
            |||||.|||||:||||.||:.|||:|:||||..||..|.||||||||||||||||:|||:|.:||
  Fly   130 QIEVFNWSASGSIITEGLATMFPTIVVYVMDVERSACPTTFMSNMLYACSILYKTRLPFLVALNK 194

Human   191 TDIIDHSFAVEWMQDFEAFQDALNQETTYVSNLTRSMSLVLDEFYSSLRVVGVSAVLGTGLDELF 255
            .|:.|..|.::||.||||||:|..:|.::||||||:|||.||.||.:||..||||..|.|..:|.
  Fly   195 IDLKDCGFVMDWMTDFEAFQEAQEEEHSFVSNLTRTMSLTLDTFYENLRTCGVSAKTGVGFTQLL 259

Human   256 VQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQLERLRKDMGSVAL---------DAGTAKD 311
            .::..:.:|||.:|:|.||: |:....|||....:.::.:.:|..:|.|         ..|.:..
  Fly   260 TKILESVDEYETDYKPVYEK-KRQERLAESATGPKPVDHVEEDGHAVPLGLSLQDPPPHTGNSIF 323

Human   312 SLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNFMQESM-AQYWKRN 372
            .::|.|.|....:      |::||.:.|        .:.:.||..|.:|:|..: ||..||:
  Fly   324 LMAPSLVPESAEI------EDEEEMEED--------AKGTAEEQNFHSFVQNHLTAQQSKRD 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GPN1NP_009197.3 ATP_bind_1 24..261 CDD:308588 145/238 (61%)
Gly-Pro-Asn (GPN)-loop, involved in dimer interface. {ECO:0000250|UniProtKB:Q9UYR9} 86..88 2/2 (100%)
CG3704NP_569872.1 Gem1 24..199 CDD:224025 114/176 (65%)
ATP_bind_1 28..268 CDD:281079 145/241 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1532
Hieranoid 1 1.000
Homologene 1 1.000 H5257
Inparanoid 1 1.050 335 1.000 Inparanoid score I2365
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1096688at2759
OrthoFinder 1 1.000 FOG0004473
OrthoInspector 1 1.000 T1073578
orthoMCL 1 0.900 OOG5_127563
Panther 1 1.100 LDO PTHR21231
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R835
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.