DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CYP4F8 and Cyp6a8

Sequence 1:NP_009184.1 Gene:CYP4F8 HGNCID:2648 Length:520 Species:Homo sapiens
Sequence 2:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster

Alignment Length:455 Identity:116/456 (25%)
Similarity:214/456 (47%) Gaps:49/456 (11%)


Human    87 GFVRWLGPITPIINLCHPDIVRSVINTSDAITDKDIVFYKTLKPWLGDGLLLSVGDKWRHHRRLL 151
            ||..:..|...:|:|   ::.:.::....:......:||......:...|....|.:||..|..|
  Fly    75 GFFFFQSPAAFVIDL---ELAKQILIKDFSNFSNKGIFYNEKDDPISAHLFNLDGAQWRLLRNKL 136

Human   152 TPAFHFNILK----PYIKIFSKSANIMHAKWQRLAMEGSTCLDVFEHISLMTLDSLQKCIFSFDS 212
            :..|....:|    ..:.:.::...:||.|     :..::.|::.:.::..|:|.:..|.|....
  Fly   137 SSTFTSGKMKLMYPTVVSVANEFMTVMHEK-----VPKNSVLEIRDLVARFTVDVIGTCAFGIQC 196

Human   213 N-CQEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFH--RACRLVHDFTDAVIQER 274
            | .:::.:|::  .....:||.||:....  ..|:.......|:..  |....:.:|...::.| 
  Fly   197 NSLRDEKAEFL--YFGKRSLVDKRHGTLL--NGFMRSYPKLARKLGMVRTAPHIQEFYSRIVTE- 256

Human   275 RRTLTSQGVDDFLQAKAKSKTLDFIDVLLLSEDKNGKE-----------LSDEDIRAEADTFMFG 328
              |:.       ::.|...|..||:|:|:  |.||.||           |:.|::.|:|..|...
  Fly   257 --TVA-------VREKEHIKRNDFMDMLI--ELKNQKEMTLENGDVVRGLTMEEVLAQAFVFFIA 310

Human   329 GHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCLKESLRLHP 393
            |.:|::|.:.:.||.||::|:.|::.|.||:|:::..: :...::....|.:|...|.|:|||:.
  Fly   311 GFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHD-QNFTYECTKDLKYLNQVLDETLRLYT 374

Human   394 PIPTFARGCTQDVVLP--DSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPM 456
            .:|...|...:..|:|  .:.||..|....|...||||:||::|:|..:.|.||.||.:..|..:
  Fly   375 IVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGRPSV 439

Human   457 AFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFRILPDHREPR----RTPEIVLRAEDGLWLRVE 517
            |::||..|||||||.:|...:.::.|||.:..|:.....:.|.    .....||..:||::|:||
  Fly   440 AWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPLVYDPKSFVLGVKDGIYLKVE 504

Human   518  517
              Fly   505  504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP4F8NP_009184.1 p450 52..504 CDD:306555 109/441 (25%)
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 114/453 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.