DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATXN2L and PBP1

Sequence 1:XP_005255118.1 Gene:ATXN2L HGNCID:31326 Length:1104 Species:Homo sapiens
Sequence 2:NP_011694.3 Gene:PBP1 SGDID:S000003410 Length:722 Species:Saccharomyces cerevisiae

Alignment Length:885 Identity:181/886 (20%)
Similarity:290/886 (33%) Gaps:307/886 (35%)


Human    97 GSARGQSTGKGPPQSPVFEGVYNNSRML---------------HFLTAVVGSTCDVKVKNGTTYE 146
            |::....|..|.|..       |||.|.               :.|...:||...|.|.:|..|.
Yeast    18 GNSDSNYTNGGVPNQ-------NNSSMFYENPEITRNFDDRQDYLLANSIGSDVTVTVTSGVKYT 75

Human   147 GIFKTLSSKFELAVDAVHR--KASEPAGGPRREDIV----DTMVFKPSDVMLVHFRNVDFNYATK 205
            |:..:.:.:....:|.|.|  :.::.......:|:.    :|::....||..:..:|:|.:...|
Yeast    76 GLLVSCNLESTNGIDVVLRFPRVADSGVSDSVDDLAKTLGETLLIHGEDVAELELKNIDLSLDEK 140

Human   206 ---DKFTDSAIAMNS----KVNGEH-------------------KEKVLQRWEGGDSNSDDYDLE 244
               .|..::..|..:    :||||.                   ||:.|::|. .:..::.:|:.
Yeast   141 WENSKAQETTPARTNIEKERVNGESNEVTKFRTDVDISGSGREIKERKLEKWT-PEEGAEHFDIN 204

Human   245 -----SDMSNGWDPNEMFKFNEENYGVKTTYDSSLSSYTVPLEKDNSEEFRQRELRAAQLAREIE 304
                 .|.|..||   .|..||:.:|||:|:|..|  ||..:.||: ..:.:|...|.::|:|||
Yeast   205 KGKALEDDSASWD---QFAVNEKKFGVKSTFDEHL--YTTKINKDD-PNYSKRLQEAERIAKEIE 263

Human   305 S-SPQYRLRIAME-----NDDGRTEEEKHSAVQRQGSGRESPSLASREGKYIPLPQRVREGPRGG 363
            | .....:.||.:     :|.|..||:.:|.|.|:|    ...||:.:....|            
Yeast   264 SQGTSGNIHIAEDRGIIIDDSGLDEEDLYSGVDRRG----DELLAALKSNSKP------------ 312

Human   364 VRCSSSRGGRPGLSSLPP---RGPHHLDNSSPGPGSEARGINGGPSRMSPKAQRPLRGAKTLSSP 425
               :|::|.|    .:||   :.|||:|                |:.:|             ||.
Yeast   313 ---NSNKGNR----YVPPTLRQQPHHMD----------------PAIIS-------------SSN 341

Human   426 SNR----PSGETSVPPPPAAPPFLPVGRMYPPRSPKSAAPAPISASCPEPPIGSAVPTSSASIPV 486
            ||:    .|.:||.|....||...|     |.::.|:.                           
Yeast   342 SNKNENAVSTDTSTPAAAGAPEGKP-----PQKTSKNK--------------------------- 374

Human   487 TSSVSDPGVGSISPASPKISLAPTDVKELSTKEPGRTLEPQELARIAGKVPGLQNEQKRFQLEEL 551
                                      |.||:||.                          |:|||
Yeast   375 --------------------------KSLSSKEA--------------------------QIEEL 387

Human   552 RKFGAQFK------------LQPSSSPENSLDPFPPRILKEEPKGKEKEVD-----GLLTSEPMG 599
            :||..:||            |:.|||...|....||:.:.:.|..|.....     |...|...|
Yeast   388 KKFSEKFKVPYDIPKDMLEVLKRSSSTLKSNSSLPPKPISKTPSAKTVSPTTQISAGKSESRRSG 452

Human   600 SPVS---SKTESVSDKEDKPPLAPSGGTEGPEQPPPPCPSQT--GSPPVGLIKGEDKDEGPVAEQ 659
            |.:|   |.|...:...........|...|.:.|......:.  |......||.::..:    |:
Yeast   453 SNISQGQSSTGHTTRSSTSLRRRNHGSFFGAKNPHTNDAKRVLFGKSFNMFIKSKEAHD----EK 513

Human   660 VKKSTLNPNAKEFNPTKPLLSVNKSTSTPTSPGPRTHSTPSIPVLTAGQSGLYSPQYISYIPQIH 724
            .|....:.|.:.|...||..:.....:|                        ....|.::.|.  
Yeast   514 KKGDDASENMEPFFIEKPYFTAPTWLNT------------------------IEESYKTFFPD-- 552

Human   725 MGPAVQA-----PQMYPYPVSNSVPGQ---QGKYRGAKGSLPPQRSDQHQPASAP-PMMQAAAAA 780
            ...|:|.     .|.....:.|:|||.   .|...|.....|     ...|:::| |||...||.
Yeast   553 EDTAIQEAQTRFQQRQLNSMGNAVPGMNPAMGMNMGGMMGFP-----MGGPSASPNPMMNGFAAG 612

Human   781 GPPLVAATPYSSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPMLQSNPRMLTSGS---HPQAIVS 842
            .        ...|:|:.|          |||.::||.|...|::.||......|:   |..|...
Yeast   613 S--------MGMYMPFQP----------QPMFYHPSMPQMMPVMGSNGAEEGGGNISPHVPAGFM 659

Human   843 SSTPQYPSAEQPTP-----QALYATVHQSYPHHATQLHAH 877
            ::.|..|......|     |.:..:.....|.:.:.:|:|
Yeast   660 AAGPGAPMGAFGYPGGIPFQGMMGSGPSGMPANGSAMHSH 699

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATXN2LXP_005255118.1 SM-ATX 122..191 CDD:291131 16/90 (18%)
PBP1 209..750 CDD:227507 123/612 (20%)
LsmAD 264..326 CDD:284215 23/68 (34%)
TFIIA 763..>948 CDD:281188 29/125 (23%)
TFIIA 882..>1074 CDD:281188
PBP1NP_011694.3 PBP1 3..722 CDD:227507 181/886 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2325641
eggNOG 1 0.900 E1_COG5180
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001718
OrthoInspector 1 1.000 T1003939
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12854
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2220
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.