DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATXN2L and Atx2

Sequence 1:XP_005255118.1 Gene:ATXN2L HGNCID:31326 Length:1104 Species:Homo sapiens
Sequence 2:NP_732033.1 Gene:Atx2 FlyBaseID:FBgn0041188 Length:1084 Species:Drosophila melanogaster

Alignment Length:1185 Identity:291/1186 (25%)
Similarity:431/1186 (36%) Gaps:403/1186 (34%)


Human    90 RPGAAAIGSARGQSTGKGPPQSPVFEGVYNNSRMLHFLTAVVGSTCDVKVKNGTTYEGIFKTLSS 154
            ||.....|:..|..   |....|..:|||||:..:|..||:|||..:|::::|..|||:|:|.|.
  Fly    31 RPTNNKAGAGGGNG---GAAVRPSAQGVYNNTFFMHSATALVGSVVEVRLRSGNIYEGVFRTFSG 92

Human   155 KFELAVD--AVHRKASEPAGG--PRREDIVDTMVFKPSDVMLVHFRNVDFNYATKDKF-TDSAIA 214
            .|::|::  |..:..:.|..|  |:.      ::|....|:.:..::.|..|||...| ||.|| 
  Fly    93 NFDIALELPACIKSKNLPEEGKVPKH------IIFPADTVVTIVAKDFDSQYATAGAFQTDGAI- 150

Human   215 MNSKVNGEH-KEKVLQRWEGGDSNSDDYDLESDMSNGWDPNEMFKFNEENYGVKTTYDSSLSSYT 278
             :.|.||.. .||.|:.|:.|.:...|.:|:| .:|||||||||:.||..:||.:|:|.||:|||
  Fly   151 -SDKCNGARPDEKELEPWDSGANGDIDIELDS-AANGWDPNEMFRKNENTFGVTSTFDDSLASYT 213

Human   279 VPLEKDNSEEFRQRELRAAQLAREIESSPQYRLRIAMENDDGRTEEEKHSAVQR----------- 332
            |||:|.:|.||::.|.:|.:||.|||::|..|.|:.:||.|   ||...:||:|           
  Fly   214 VPLDKGDSLEFKEAEAKAEKLAAEIENNPTCRDRLDLENGD---EEALFAAVERPSTEQDQRGDR 275

Human   333 ---------------------------QGSG----RESPSLASREGKYIPLPQRVREGP------ 360
                                       :|:|    ||:.|    ..:||....|...||      
  Fly   276 GDRERNDRDREREERDRDRDRDRGNKPRGAGDFQLRETMS----SDRYITKQTRSITGPQLSHVG 336

Human   361 ---------------------------RGGVRCSSS----RGGRPGLSSLP-------------- 380
                                       :||...|::    .||..|:...|              
  Fly   337 MSSQGSGRDRDTRGDGSMMMQSGGGSGQGGSTQSTAALMLAGGLKGVGPAPSANASADSSSKYSG 401

Human   381 ---------PRGPHHLDNSSPGPGSE---ARGINGG----------PSRMSP------------- 410
                     |:|...:.|:.|..||.   ::|.||.          ||...|             
  Fly   402 GSMVKRKTVPQGGKVMRNNVPTGGSNVSVSQGGNGNSVGQNKGGYQPSMGMPSQYSYQGNSQIMH 466

Human   411 -----KAQRPLRGAKTLSSPSNRPSGETSVPPPPAAPPFLPVGRMYPPRSPKSAAPAPISASCPE 470
                 :.|..:.||..|:..||   ..|:.|        ||..:|...:..:|.:......   |
  Fly   467 GSSQYRNQSHMGGANKLNGDSN---ANTNKP--------LPQRQMRQYQGSQSNSSLNYGG---E 517

Human   471 P-PIGSAVPTSSASIPVTSSVSDPGVGSISPASPKISLAPTDVKELSTKEPGRTLEPQELARIAG 534
            | .:|..|..|....|..:|.|.|    :..|.|:    ....::...::..:..:|.:..:...
  Fly   518 PQSLGKPVHGSHGGHPGQNSNSPP----LQTAGPQ----QQQQQQQQQQQQQQQQQPPQQQQHQN 574

Human   535 KVPGLQNEQ-------KRFQLEELRKFGAQFKLQPS--SSPEN---------------------S 569
            ..|..||.|       :..|::|||:||..|:|.||  |.|:.                     .
  Fly   575 IQPQGQNTQPARQVRTRDNQMQELRQFGQDFQLAPSNTSPPQQQQQQQQQQQQHQVQQQQQRALQ 639

Human   570 LDPFPPRILKEEPKGKEKEV----------DGLLT-------SEPMGSP---------------- 601
            ....||:..:::.:.::..|          ...|:       .:|..:|                
  Fly   640 QSASPPQQQQQQQQQQQHVVLHQVPQTHLHQAALSQPHYVPQQQPQQAPLPQQQHVPHHMQQKAQ 704

Human   602 ----VSSKTESVSDKEDKPPLA---PSGGTEGPEQPPPPC-----PSQTGSP-----PVGLIKGE 649
                |.::.:.|..:....|..   |....:.|.|.|.|.     |.|| ||     || |::..
  Fly   705 QQQLVETQHQHVQKQHQSQPQVQQPPPQLLQDPSQQPLPIYHTMPPPQT-SPVVVTSPV-LLEQP 767

Human   650 DKDEGPVAEQVKKSTLNPNAKEFNPTKPLLSVNKSTSTPTSPGPRTHSTPSIPVLTAGQSGLYSP 714
            .....||.:|.:...|.....|.:|..|    :.:|:|||.    ..|||:..|:.:..|...:|
  Fly   768 PPQPMPVVQQQQTQQLATPKPEVSPAPP----SSNTTTPTG----IASTPTAGVIASAGSEKTTP 824

Human   715 QYISYIPQIHMGPAVQAPQMYPYPVSNS--VP-GQQGKYRGAKGSLP------------------ 758
                               ..|.|.|||  || |......||.|:.|                  
  Fly   825 -------------------AAPTPTSNSATVPTGTAATAGGATGTTPVVKKHVLNPSAKPFTPRG 870

Human   759 ---PQRSDQHQPASAPPMMQAAAAAGPPLVAATPYSSYI-----PYNPQQFP--GQPAMMQPMAH 813
               |..|..|.|.:..||.......|..:..|.....|:     |:.||..|  |||..:: .::
  Fly   871 PSTPNPSRPHTPQTPVPMTNIYTTTGGHVPPAANQPIYVMQPQHPFPPQTHPQAGQPPRLR-RSN 934

Human   814 YPSQPVFAPMLQSNPRMLTSGSHPQAIVSSSTPQYPSAEQPTPQ------ALYATVHQSYPHHAT 872
            ||      ||..|...:..|.:..|.::::.         |.||      |.:....||:.:...
  Fly   935 YP------PMAASQMHVSASAATGQPLITAG---------PIPQFIQYGHAPHQQQFQSHTYAPM 984

Human   873 QLHAHQPQPATTPTGSQ-PQSQHAAPSPVQQHQAGQAPHLGSGQPQQNLYHPGALTGTPPSLPPG 936
            |:..:..||......:| |||  ..|||              |||.|. :||      ||.  |.
  Fly   985 QMRVYPDQPQQLQFMTQTPQS--TTPSP--------------GQPHQQ-FHP------PPQ--PS 1024

Human   937 PSAQSPQSSF--PQPAAVY---AIHHQQL--PHGFTNMAHVTQAHVQTGITAAPPPHPGAPHPPQ 994
            |:...||.:|  |..||.|   .:|.|.|  .|.|                  |||.|  .||.|
  Fly  1025 PAGGGPQPAFTPPTQAATYQLMCVHPQSLLANHYF------------------PPPTP--QHPQQ 1069

Human   995 -------VMLLHPPQ 1002
                   ||..|.||
  Fly  1070 NQQQYQIVMQQHQPQ 1084

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATXN2LXP_005255118.1 SM-ATX 122..191 CDD:291131 22/73 (30%)
PBP1 209..750 CDD:227507 176/759 (23%)
LsmAD 264..326 CDD:284215 31/62 (50%)
TFIIA 763..>948 CDD:281188 51/201 (25%)
TFIIA 882..>1074 CDD:281188 41/137 (30%)
Atx2NP_732033.1 SM-ATX 61..128 CDD:291131 22/73 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C367038834
eggNOG 1 0.900 E1_COG5180
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3562
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001718
OrthoInspector 1 1.000 T609401
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12854
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2220
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.