DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATXN2L and Atxn2l

Sequence 1:XP_005255118.1 Gene:ATXN2L HGNCID:31326 Length:1104 Species:Homo sapiens
Sequence 2:XP_017444890.1 Gene:Atxn2l RGDID:1565868 Length:1133 Species:Rattus norvegicus

Alignment Length:1137 Identity:1045/1138 (92%)
Similarity:1058/1138 (93%) Gaps:37/1138 (3%)


Human     1 MLKPQPLQQPSQPQQPPPTQQAVARRPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAA 65
            ||||||.||.||||||||||||||||||||||||||||||||..:|||||||...||||||.|||
  Rat     1 MLKPQPPQQTSQPQQPPPTQQAVARRPPGGTSPPNGGLPGPLPATAAPPGPPTVVSPCLGPAAAA 65

Human    66 GSGLRRGAEGILAPQPPPPQQHQERPGAAAIGSARGQSTGKGPPQSPVFEGVYNNSRMLHFLTAV 130
            |||||||||.|||  .|.||||||||||.||||.|||:|||||||||||||||||||||||||||
  Rat    66 GSGLRRGAESILA--APAPQQHQERPGAVAIGSVRGQTTGKGPPQSPVFEGVYNNSRMLHFLTAV 128

Human   131 VGSTCDVKVKNGTTYEGIFKTLSSKFELAVDAVHRKASEPAGGPRREDIVDTMVFKPSDVMLVHF 195
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||||
  Rat   129 VGSTCDVKVKNGTTYEGIFKTLSSKFELAVDAVHRKASEPAGGPRREDIVDTMVFKPSDVLLVHF 193

Human   196 RNVDFNYATKDKFTDSAIAMNSKVNGEHKEKVLQRWEGGDSNSDDYDLESDMSNGWDPNEMFKFN 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   194 RNVDFNYATKDKFTDSAIAMNSKVNGEHKEKVLQRWEGGDSNSDDYDLESDMSNGWDPNEMFKFN 258

Human   261 EENYGVKTTYDSSLSSYTVPLEKDNSEEFRQRELRAAQLAREIESSPQYRLRIAMENDDGRTEEE 325
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   259 EENYGVKTTYDSSLSSYTVPLEKDNSEEFRQRELRAAQLAREIESSPQYRLRIAMENDDGRTEEE 323

Human   326 KHSAVQRQGSGRESPSLASREGKYIPLPQRVREGPRGGVRCSSSRGGRPGLSSLPPRGPHHLDNS 390
            |||||||||||||||||.|||||||||||||||||||||||||||||||||||||||||||||||
  Rat   324 KHSAVQRQGSGRESPSLVSREGKYIPLPQRVREGPRGGVRCSSSRGGRPGLSSLPPRGPHHLDNS 388

Human   391 SPGPGSEARGINGGPSRMSPKAQRPLRGAKTLSSPSNRPSGETSVPPPPAAPPFLPVGRMYPPRS 455
            ||||||||||||||||||||||||||||.||||||:||||||.||||..||.|||||||||||||
  Rat   389 SPGPGSEARGINGGPSRMSPKAQRPLRGGKTLSSPNNRPSGEASVPPTSAALPFLPVGRMYPPRS 453

Human   456 PKSAAPAPISASCPEPPIGSAVPTSSASIPVTSSVSDPGVGSISPASPKISLAPTDVKELSTKEP 520
            ||||||||:||||||||||||| .|||||||||||.|||.|||||||||:||||||||||.||||
  Rat   454 PKSAAPAPVSASCPEPPIGSAV-ASSASIPVTSSVVDPGAGSISPASPKLSLAPTDVKELPTKEP 517

Human   521 GRTLEPQELARIAGKVPGLQNEQKRFQLEELRKFGAQFKLQPSSSPENSLDPFPPRILKEEPKGK 585
            .|:||.|||||||||||||||||||||||||||||||||||||||.|..|||||.||||||.|||
  Rat   518 SRSLEAQELARIAGKVPGLQNEQKRFQLEELRKFGAQFKLQPSSSSETGLDPFPSRILKEEAKGK 582

Human   586 EKEVDGLLTSEPMGSPVSSKTESVSDKEDKPPLAPSGGTEGPEQPPPPCPSQTGSPPVGLIKGED 650
            ||||||||||:|||||||||.||:.|||||.|||...|:|||||..|||||||||||||||||:|
  Rat   583 EKEVDGLLTSDPMGSPVSSKAESILDKEDKVPLAAVAGSEGPEQLQPPCPSQTGSPPVGLIKGDD 647

Human   651 KDEGPVAEQVKKSTLNPNAKEFNPTKPLLSVNKSTSTPTSPGPRTHSTPSIPVLTAGQSGLYSPQ 715
            |:||||.||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   648 KEEGPVTEQVKKSTLNPNAKEFNPTKPLLSVNKSTSTPTSPGPRTHSTPSIPVLTAGQSGLYSPQ 712

Human   716 YISYIPQIHMGPAVQAPQMYPYPVSNSVPGQQGKYRGAK-------------------------- 754
            |||||||||||||||||||||||||||||||||||||||                          
  Rat   713 YISYIPQIHMGPAVQAPQMYPYPVSNSVPGQQGKYRGAKGEQGWEGQLGLPSASWQAKTPELCTV 777

Human   755 -----GSLPPQRSDQHQPASAPPMMQ-AAAAAGPPLVAATPYSSYIPYNPQQFPGQPAMMQPMAH 813
                 ||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||
  Rat   778 YPPPTGSLPPQRSDQHQPASAPPMMQAAAAAAGPPLVAATPYSSYIPYNPQQFPGQPAMMQPMAH 842

Human   814 YPSQPVFAPMLQSNPRMLTSGSHPQAIVSSSTPQYPSAEQPTPQALYATVHQSYPHHATQLHAHQ 878
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.||
  Rat   843 YPSQPVFAPMLQSNPRMLTSGSHPQAIVSSSTPQYPSAEQPTPQALYATVHQSYPHHATQLHGHQ 907

Human   879 PQPATTPTGSQPQSQHAAPSPVQQHQAGQAPHLGSGQPQQNLYHPGALTGTPPSLPPGPSAQSPQ 943
            |||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||
  Rat   908 PQPATTPTGSQPQSQHAAPSPV-QHQAGQAPHLGSGQPQQNLYHPGALTGTPPSLPPGPSAQSPQ 971

Human   944 SSFPQPAAVYAIH-HQQLPHGFTNMAHVTQAHVQTGITAAPPPHPGAPHPPQVMLLHPPQSHGGP 1007
            ||||||||||||| ||||||||||||||||||||||:|||||||||||||||||||||||.||||
  Rat   972 SSFPQPAAVYAIHPHQQLPHGFTNMAHVTQAHVQTGVTAAPPPHPGAPHPPQVMLLHPPQGHGGP 1036

Human  1008 PQGAVPQSGVPALSASTPSPYPYIGHPQGEQPGQAPGFPGGADDRILCRVGRSHSRRRQGLAPGS 1072
            ||||||.||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1037 PQGAVPPSGVPALSASTPSPYPYIGHPQGEQPGQAPGFPGGADDRILCRVGRSHSRRRQGLAPGS 1101

Human  1073 VLCFPPSSLSCDPAAPLPTASPALSDPDCLLT 1104
            ||||||||||||||||||||||||||||||||
  Rat  1102 VLCFPPSSLSCDPAAPLPTASPALSDPDCLLT 1133

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATXN2LXP_005255118.1 SM-ATX 122..191 CDD:291131 69/69 (100%)
PBP1 209..750 CDD:227507 505/541 (93%)
LsmAD 264..326 CDD:284215 62/62 (100%)
TFIIA 763..>948 CDD:281188 183/186 (98%)
TFIIA 882..>1074 CDD:281188 188/193 (97%)
Atxn2lXP_017444890.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C366695231
eggNOG 1 0.900 E1_COG5180
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H16513
Inparanoid 1 1.050 2065 1.000 Inparanoid score I1277
OMA 1 1.010
OrthoDB 1 1.010 D116171at7742
OrthoFinder 1 1.000 FOG0001718
OrthoInspector 1 1.000 T2461708
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12854
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1212.460

Return to query results.
Submit another query.