DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATXN2L and atxn2l

Sequence 1:XP_005255118.1 Gene:ATXN2L HGNCID:31326 Length:1104 Species:Homo sapiens
Sequence 2:XP_005163856.1 Gene:atxn2l ZFINID:ZDB-GENE-030131-3246 Length:1004 Species:Danio rerio

Alignment Length:1118 Identity:474/1119 (42%)
Similarity:602/1119 (54%) Gaps:253/1119 (23%)


Human    49 PGPPAAASPCLGPVAAAGSGLRRGAEGILAPQPPPPQQHQERPGAAAIGSARGQSTGKGPPQS-P 112
            |||             .|.....|..|.:|...|....::..||       |.:::.|.|.|| |
Zfish     9 PGP-------------GGRKTSNGTSGSMASSVPGSNSNRPNPG-------RNRNSVKTPSQSPP 53

Human   113 VFEGVYNNSRMLHFLTAVVGSTCDVKVKNGTTYEGIFKTLSSKFELAVDAVHRKASEPAGG---- 173
            |||||||||||||||||||||.|||.||||:.||||||||||:.||||||||:..:|...|    
Zfish    54 VFEGVYNNSRMLHFLTAVVGSRCDVMVKNGSLYEGIFKTLSSRCELAVDAVHKVKNEEGDGGGGG 118

Human   174 -----PRREDIVDTMVFKPSDVMLVHFRNVDFNYATKDKFTDSAIAMNSKVNGEHKEKVLQRWEG 233
                 ||:|:|.|||:|.|||::.:..|:||.||||:|.||||||. :|::||:|:|||||||:|
Zfish   119 GTAVHPRKEEITDTMIFGPSDLVTMICRDVDLNYATRDTFTDSAIG-SSRLNGDHREKVLQRWDG 182

Human   234 GDSNSDDYDLESDMSNGWDPNEMFKFNEENYGVKTTYDSSLSSYTVPLEKDNSEEFRQRELRAAQ 298
            ||||.:::||::|.:||||.:|||:||||.||||:|||||||.||||||:.:||.|||||.|||:
Zfish   183 GDSNGENFDLDADTANGWDASEMFRFNEETYGVKSTYDSSLSMYTVPLERGSSEGFRQREARAAR 247

Human   299 LAREIESSPQYRLRIAMENDDGRTEEEKHSAVQR--------QGSGRESP---SLASREGKYIPL 352
            ||.|||:|.|||.|:|:|||:|||:|:|.|||.|        :..||:||   |..|||||||| 
Zfish   248 LANEIEASSQYRHRVALENDEGRTDEDKFSAVVRDREREAAERERGRDSPGFSSAGSREGKYIP- 311

Human   353 PQRVRE--------GPRGG-VRCSSSRGGRPGLSS-------------LPP---------RG--- 383
            |||.||        |.||| |....:|..|||.||             |||         ||   
Zfish   312 PQRAREREMGVSGRGERGGAVSTLPNRTNRPGPSSSSPRPLPSANSQALPPTDRNSSLSVRGGFS 376

Human   384 ------------------------PHHLDNSSPGPGS---EARGINGGPSRMSPKAQRPLRGAKT 421
                                    ||.|.:|...|.|   .||.:||    :|||:||..:..:.
Zfish   377 THQSQSSTPTQSRPSEPGHSSPPSPHTLSHSLSHPQSLSDVARPVNG----VSPKSQRTGQTNRN 437

Human   422 LSSPSNRPSGETSVPPPPAAPPFLPVGRMYPPRSPKSAAPAPISASCPEPPIGSAVPTSSASIPV 486
            :.:.::..|...|                   ||||..||       |:.|:            :
Zfish   438 MRTSNSHSSPTVS-------------------RSPKPDAP-------PQDPL------------L 464

Human   487 TSSVSDPGVGSISPASPKISLAPTDVKELSTKEPGRT-LEPQELARIAGKVPGLQNEQKRFQL-E 549
            |.|..||   |..|..| ..|.|.||.|:.:||...: :.|||     ||...:.:.|:|.|: |
Zfish   465 TGSYLDP---SSKPVGP-TPLFPVDVNEILSKERMESPVGPQE-----GKSNKIPSVQQRSQISE 520

Human   550 ELRKFGAQFKLQ--PSSSPENSLD------------------PFPPRI----LKEEPKGKEKEVD 590
            ||||||..|:||  |.:.|..|..                  |.||..    |..|.:.:|...:
Zfish   521 ELRKFGNTFRLQQNPKTLPTESTQANPAHNTQTDPAAPTEAKPAPPTTPNTELSAEERSRETNPE 585

Human   591 GLLTSEPMGSPVSSKTESVSDKEDKPPLAPSGGTEGPEQPPPPCPSQTGSPPVGLIKGEDKDEGP 655
            |.:||.|  .|.:|.:.........||  ..|.|.|..||.....|:.|.|     :..::.|| 
Zfish   586 GPVTSTP--PPATSISAPSGIGMQNPP--AEGQTAGAPQPARTPGSEDGKP-----EAPERSEG- 640

Human   656 VAEQVKKSTLNPNAKEFNPTKPLLSVNKSTSTPTSPGPRTHSTPSIPVLT-AGQSGLYSPQYISY 719
            :.:||||||||||||||||||..||:.|.::|||.|.| |..:|::.:.| .||..:|:|||:||
Zfish   641 MTDQVKKSTLNPNAKEFNPTKAPLSMVKPSATPTPPRP-TPPSPTVVLQTQPGQGAVYNPQYLSY 704

Human   720 IPQIHM---GPAVQAPQMYPYPVSNSVPGQQGKYRGAKGSLPPQRSDQHQPASAPPMMQAAAAAG 781
            :.|:.:   |.:|| ||: ||....:|  .||||...|||:...|.|  ..:|||||:|||:|||
Zfish   705 VSQVPIQIQGHSVQ-PQI-PYSYMTAV--SQGKYPRTKGSVVTPRPD--HSSSAPPMIQAASAAG 763

Human   782 PPLVAATPY-SSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPMLQSNPRMLTSGSHPQAIVSSST 845
            |||| |:|| .||:.|| |..|..|       |||...|:: |||..||||.||.||||: ....
Zfish   764 PPLV-ASPYPPSYLQYN-QVIPAMP-------HYPGHQVYS-MLQGGPRMLGSGGHPQAL-GPPG 817

Human   846 PQYP-SAEQPT--PQALYATVHQSYPHHATQLHAHQPQPATTPTGSQPQSQHAAPSPVQQHQAGQ 907
            |||| ..|.|:  .|.:||.  ||:.||:..:|   |||::|||||||..||.||||.|..|:|.
Zfish   818 PQYPGQTEGPSAPQQGMYAP--QSFSHHSGSIH---PQPSSTPTGSQPPPQHPAPSPGQSGQSGP 877

Human   908 APHLGSGQPQQNLYHPGALTG-TPPSLPPGPSAQSPQSSFPQPAAVYAI-HHQQLPHGFTNMAHV 970
            .|        |:|||.|.|:. |||:||||.|  |||:|:....  |:: .||.|||.::::..:
Zfish   878 QP--------QSLYHSGPLSAPTPPNLPPGHS--SPQASYSLQG--YSLPGHQPLPHPYSSLGQL 930

Human   971 TQAHVQTGITAAPPPHPGAPHPPQVMLLH-PPQSHGGPPQGAVPQSG-----------VPALSAS 1023
            |||||...::.  |.|.|...||.||||| .||...||..|..||.|           || :.|.
Zfish   931 TQAHVPGALSG--PHHTGGHGPPPVMLLHAAPQQGSGPQHGPPPQQGAHQHFTYLGPQVP-VQAH 992

Human  1024 TPSPYPYIGHPQG 1036
            .|...||  ||.|
Zfish   993 NPQQIPY--HPSG 1003

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATXN2LXP_005255118.1 SM-ATX 122..191 CDD:291131 50/78 (64%)
PBP1 209..750 CDD:227507 252/643 (39%)
LsmAD 264..326 CDD:284215 45/62 (73%)
TFIIA 763..>948 CDD:281188 95/190 (50%)
TFIIA 882..>1074 CDD:281188 73/170 (43%)
atxn2lXP_005163856.1 SM-ATX 63..142 CDD:291131 50/79 (63%)
LsmAD 213..275 CDD:284215 45/62 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C366967495
eggNOG 1 0.900 E1_COG5180
Hieranoid 1 1.000
Homologene 1 1.000 H16513
Inparanoid 1 1.050 650 1.000 Inparanoid score I4665
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001718
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132032
Panther 1 1.100 LDO PTHR12854
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2220
TreeFam 1 0.960
ZFIN 1 1.500
1212.380

Return to query results.
Submit another query.