DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATXN2L and SPBC21B10.03c

Sequence 1:XP_005255118.1 Gene:ATXN2L HGNCID:31326 Length:1104 Species:Homo sapiens
Sequence 2:NP_595684.1 Gene:SPBC21B10.03c PomBaseID:SPBC21B10.03c Length:791 Species:Schizosaccharomyces pombe

Alignment Length:805 Identity:179/806 (22%)
Similarity:279/806 (35%) Gaps:233/806 (29%)


Human   209 TDSAIAMNSKVNGEHKEKVLQRW--EGGDSNSDDYDLESDMSN-GWDPNEMFKFNEENYGVKTTY 270
            ||.||:...:.  |.:::.|:||  :..|:......||....| .||   .|..||:.:|||:.:
pombe   103 TDVAISAEKRT--ETRQRELRRWMPDPEDAGVPLAGLEESTDNVEWD---QFATNEKLFGVKSHF 162

Human   271 DSSLSSYTVPLEKDNSEEFRQRELRAAQLAREIESSPQYRLRIAME-----NDDGRTEEEKHSAV 330
            |..|  ||..:::.: .:::::|..|.::|:|||.:....:.||.|     :|.|..||:.:|.|
pombe   163 DEDL--YTSRIDRSH-PKYKEKEQEADRIAKEIEGTVTNNIHIAEERGLKVDDSGLDEEDLYSGV 224

Human   331 QRQ--------GSGRESPSLASREGKYIPLPQRVREGPRGGVRCSSSRGGRPGLSSLPPRGP--- 384
            .|.        .|...:.:...::.|....|.:                 .|....:||..|   
pombe   225 HRSIDVVRNYTRSNAYNKNNKDQKPKNHEAPHQ-----------------HPQQKVVPPDDPAIV 272

Human   385 --HHLD-NSSPGPGSEA--RGIN----GGP-SRMSPKAQ-----RPLRGAKTLSSPSNRPSGETS 434
              .||. ..:|||.|.|  |..|    .|| ||...:.|     :..:..|..|..|.:||...|
pombe   273 SHRHLALPRAPGPDSRAAERFFNARRKAGPLSRREKEGQIKEFMQFSQSLKIGSLDSKQPSSTKS 337

Human   435 VPPPPAAPPFLPVGRMYPPRSPKSAAPAPISASCP-----EPPIGSAVPTSSASI-PVTSSVSDP 493
            |.....|..     :..|..|.::   .|..:..|     |.|:.||...||..: .|..:.|.|
pombe   338 VAEVKVADE-----KQLPDASSQA---TPADSKEPRKEEAEKPVTSATEVSSEKVEKVDGNTSSP 394

Human   494 GVGSISPAS-PKISLAPTDVKELSTKEPGRTLEPQELA---RIAGKV--PGLQNEQKRFQLEELR 552
            ......|:: |:.....|..||.:..:.|..|..:.::   .:|..|  ||              
pombe   395 SKEEEKPSTEPEKPSVVTQRKETTGTKLGTKLNAKAISFKPNVAAPVFTPG-------------- 445

Human   553 KFGAQFKLQPSSSPENSLDPFPPRILKEEPKGKEKEVDGLLTSEP----------------MGSP 601
                :|.:....:|.|:..|..|    ::....|..:.......|                ...|
pombe   446 ----KFTIPSKPAPVNASRPMMP----QQSNNSEASIPSTTPQSPSVVSNGENKPSSSPVFFNGP 502

Human   602 VSSKTESVSDKEDKPPLAPSGGTE--GPEQPPPP--CPSQTGSPPVGLIK--GEDKDEGPVAEQV 660
            |||:.|.:.|..:   :..:.|.|  |.||...|  ||....:.|..|.:  ...:.||......
pombe   503 VSSEKEPILDNFN---VFKNVGEEHQGAEQIDKPFSCPPTWNTGPNSLQQTIANSRPEGNSGSAK 564

Human   661 KKSTLNPNAKEF---------------NPTKPLLSVN----------KSTSTPTSPGPRTHSTPS 700
            |.:..||.....               .||.|.:.|.          ::.|..||..|..:.|| 
pombe   565 KAAAANPMIPSIVLPNSAMPSAMPMYPTPTMPYIPVGYPVPGYTPYMRNPSQHTSVAPSPNGTP- 628

Human   701 IPVLTAGQSGLYSPQYISYIPQIHMGPAVQAPQMY-PYPVSNSVPGQQGKYRGAKGSLPPQRSDQ 764
                |:|.|.......|.|:          |||.. ||.:....|...|  |||..         
pombe   629 ----TSGNSSTVGSPMIGYM----------APQFIPPYAMPQFPPSGNG--RGASA--------- 668

Human   765 HQPAS--APPM--MQAAAAAG-PPLVAATPYSSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPML 824
              ||:  .|.|  |.|....| ||:     |..|.|.|        .||.  .||   |::....
pombe   669 --PATYFVPQMGGMMAYTMNGVPPM-----YGQYAPNN--------GMMN--MHY---PMYGDSR 713

Human   825 QSNPRMLTSGSHPQAIVSSSTPQYPSAEQPTPQALYATVHQSYPHHATQLHAHQPQPATTPTGSQ 889
            :||.:...:.|:.:.                     :.||::  ::|:...:|.       ..|.
pombe   714 RSNSQRSFNSSNGKR---------------------SNVHKN--NNASNTFSHS-------NAST 748

Human   890 PQSQHAAPSPVQQHQAGQAPHLGSG 914
            ..|.:|||:...:..:..||.:..|
pombe   749 SSSLNAAPNTTAKSSSQTAPPVSKG 773

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATXN2LXP_005255118.1 SM-ATX 122..191 CDD:291131
PBP1 209..750 CDD:227507 143/635 (23%)
LsmAD 264..326 CDD:284215 20/67 (30%)
TFIIA 763..>948 CDD:281188 33/158 (21%)
TFIIA 882..>1074 CDD:281188 8/34 (24%)
SPBC21B10.03cNP_595684.1 PBP1 1..739 CDD:227507 170/763 (22%)
LsmAD 156..220 CDD:284215 20/67 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2148
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001718
OrthoInspector 1 1.000 T998703
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12854
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2220
TreeFam 00.000 Not matched by this tool.
55.180

Return to query results.
Submit another query.