DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATXN2L and Atxn2l

Sequence 1:XP_005255118.1 Gene:ATXN2L HGNCID:31326 Length:1104 Species:Homo sapiens
Sequence 2:XP_006507783.1 Gene:Atxn2l MGIID:2446242 Length:1102 Species:Mus musculus

Alignment Length:1106 Identity:1047/1107 (95%)
Similarity:1060/1107 (96%) Gaps:6/1107 (1%)


Human     1 MLKPQPLQQPSQPQQPPPTQQAVARRPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAA 65
            ||||||.||.||||||||||||||||.|||||||||||||||..:|||||||||.||||||.|||
Mouse     1 MLKPQPPQQTSQPQQPPPTQQAVARRSPGGTSPPNGGLPGPLTATAAPPGPPAAVSPCLGPAAAA 65

Human    66 GSGLRRGAEGILAPQPPPPQQHQERPGAAAIGSARGQSTGKGPPQSPVFEGVYNNSRMLHFLTAV 130
            |||||||||.|||...||  ||||||||.||||.|||:|||||||||||||||||||||||||||
Mouse    66 GSGLRRGAESILAASAPP--QHQERPGAVAIGSVRGQTTGKGPPQSPVFEGVYNNSRMLHFLTAV 128

Human   131 VGSTCDVKVKNGTTYEGIFKTLSSKFELAVDAVHRKASEPAGGPRREDIVDTMVFKPSDVMLVHF 195
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||||
Mouse   129 VGSTCDVKVKNGTTYEGIFKTLSSKFELAVDAVHRKASEPAGGPRREDIVDTMVFKPSDVLLVHF 193

Human   196 RNVDFNYATKDKFTDSAIAMNSKVNGEHKEKVLQRWEGGDSNSDDYDLESDMSNGWDPNEMFKFN 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   194 RNVDFNYATKDKFTDSAIAMNSKVNGEHKEKVLQRWEGGDSNSDDYDLESDMSNGWDPNEMFKFN 258

Human   261 EENYGVKTTYDSSLSSYTVPLEKDNSEEFRQRELRAAQLAREIESSPQYRLRIAMENDDGRTEEE 325
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   259 EENYGVKTTYDSSLSSYTVPLEKDNSEEFRQRELRAAQLAREIESSPQYRLRIAMENDDGRTEEE 323

Human   326 KHSAVQRQGSGRESPSLASREGKYIPLPQRVREGPRGGVRCSSSRGGRPGLSSLPPRGPHHLDNS 390
            |||||||||||||||||.|||||||||||||||||||||||||||||||||||||||||||||||
Mouse   324 KHSAVQRQGSGRESPSLVSREGKYIPLPQRVREGPRGGVRCSSSRGGRPGLSSLPPRGPHHLDNS 388

Human   391 SPGPGSEARGINGGPSRMSPKAQRPLRGAKTLSSPSNRPSGETSVPPPPAAPPFLPVGRMYPPRS 455
            ||||||||||||||||||||||||||||||||||||||||||.||||..||.|||||||||||||
Mouse   389 SPGPGSEARGINGGPSRMSPKAQRPLRGAKTLSSPSNRPSGEASVPPTSAALPFLPVGRMYPPRS 453

Human   456 PKSAAPAPISASCPEPPIGSAVPTSSASIPVTSSVSDPGVGSISPASPKISLAPTDVKELSTKEP 520
            ||||||||:||||||||||||| .|||||||||||.|||.|||||||||:||.|||||||.||||
Mouse   454 PKSAAPAPVSASCPEPPIGSAV-ASSASIPVTSSVVDPGAGSISPASPKLSLTPTDVKELPTKEP 517

Human   521 GRTLEPQELARIAGKVPGLQNEQKRFQLEELRKFGAQFKLQPSSSPENSLDPFPPRILKEEPKGK 585
            .|.||.|||||||||||||||||||||||||||||||||||||||||..|||||.||||||.|||
Mouse   518 SRNLEAQELARIAGKVPGLQNEQKRFQLEELRKFGAQFKLQPSSSPETGLDPFPSRILKEEAKGK 582

Human   586 EKEVDGLLTSEPMGSPVSSKTESVSDKEDKPPLAPSGGTEGPEQPPPPCPSQTGSPPVGLIKGED 650
            ||||||||||:||||||||||||:.|||||.|:|..||||||||.|.||||||||||||||||::
Mouse   583 EKEVDGLLTSDPMGSPVSSKTESILDKEDKVPMAGVGGTEGPEQLPAPCPSQTGSPPVGLIKGDE 647

Human   651 KDEGPVAEQVKKSTLNPNAKEFNPTKPLLSVNKSTSTPTSPGPRTHSTPSIPVLTAGQSGLYSPQ 715
            |:||||.||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   648 KEEGPVTEQVKKSTLNPNAKEFNPTKPLLSVNKSTSTPTSPGPRTHSTPSIPVLTAGQSGLYSPQ 712

Human   716 YISYIPQIHMGPAVQAPQMYPYPVSNSVPGQQGKYRGAKGSLPPQRSDQHQPASAPPMMQ-AAAA 779
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||
Mouse   713 YISYIPQIHMGPAVQAPQMYPYPVSNSVPGQQGKYRGAKGSLPPQRSDQHQPASAPPMMQAAAAA 777

Human   780 AGPPLVAATPYSSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPMLQSNPRMLTSGSHPQAIVSSS 844
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   778 AGPPLVAATPYSSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPMLQSNPRMLTSGSHPQAIVSSS 842

Human   845 TPQYPSAEQPTPQALYATVHQSYPHHATQLHAHQPQPATTPTGSQPQSQHAAPSPVQQHQAGQAP 909
            |||||:|||||||||||||||||||||||||.|||||||||||||||||||||||| ||||||||
Mouse   843 TPQYPAAEQPTPQALYATVHQSYPHHATQLHGHQPQPATTPTGSQPQSQHAAPSPV-QHQAGQAP 906

Human   910 HLGSGQPQQNLYHPGALTGTPPSLPPGPSAQSPQSSFPQPAAVYAIH-HQQLPHGFTNMAHVTQA 973
            ||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||
Mouse   907 HLGSGQPQQNLYHPGALTGTPPSLPPGPSAQSPQSSFPQPAAVYAIHPHQQLPHGFTNMAHVTQA 971

Human   974 HVQTGITAAPPPHPGAPHPPQVMLLHPPQSHGGPPQGAVPQSGVPALSASTPSPYPYIGHPQGEQ 1038
            |||||:|||||||||||||||||||||||.||||||||||.||||||||||||||||||||||||
Mouse   972 HVQTGVTAAPPPHPGAPHPPQVMLLHPPQGHGGPPQGAVPPSGVPALSASTPSPYPYIGHPQGEQ 1036

Human  1039 PGQAPGFPGGADDRILCRVGRSHSRRRQGLAPGSVLCFPPSSLSCDPAAPLPTASPALSDPDCLL 1103
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1037 PGQAPGFPGGADDRILCRVGRSHSRRRQGLAPGSVLCFPPSSLSCDPAAPLPTASPALSDPDCLL 1101

Human  1104 T 1104
            |
Mouse  1102 T 1102

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATXN2LXP_005255118.1 SM-ATX 122..191 CDD:291131 69/69 (100%)
PBP1 209..750 CDD:227507 508/541 (94%)
LsmAD 264..326 CDD:284215 62/62 (100%)
TFIIA 763..>948 CDD:281188 182/186 (98%)
TFIIA 882..>1074 CDD:281188 188/193 (97%)
Atxn2lXP_006507783.1 SM-ATX 120..188 CDD:291131 68/68 (100%)
LsmAD 262..324 CDD:284215 62/62 (100%)
TFIIA 880..>1072 CDD:281188 188/193 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C366695019
eggNOG 1 0.900 E1_COG5180
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H16513
Inparanoid 1 1.050 1976 1.000 Inparanoid score I1623
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D147480at33208
OrthoFinder 1 1.000 FOG0001718
OrthoInspector 1 1.000 T2445292
orthoMCL 1 0.900 OOG5_132032
Panther 1 1.100 LDO PTHR12854
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2220
TreeFam 1 0.960
1515.300

Return to query results.
Submit another query.