DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATXN2L and atx-2

Sequence 1:XP_005255118.1 Gene:ATXN2L HGNCID:31326 Length:1104 Species:Homo sapiens
Sequence 2:NP_001255079.1 Gene:atx-2 WormBaseID:WBGene00000231 Length:1026 Species:Caenorhabditis elegans

Alignment Length:1123 Identity:259/1124 (23%)
Similarity:371/1124 (33%) Gaps:352/1124 (31%)


Human   120 NSRMLHFLTAVVGSTCDVKVKNGTTYEGIFKTLSSKFELAVDAVHRKASEPAGGPRR--EDIVDT 182
            |..:|..:..::|....:...:...|.|:...:|..|:..:..|.....|......|  .:..|.
 Worm    98 NGDVLSAINDMIGRVIIINTTDKKRYSGVLGAVSQDFDFGMQCVVEITKENENNLLRTESECRDK 162

Human   183 MVFKPSDVMLVHFRNVDFNYATKD--------KF-TDSAIAMNSKVNGEHKEKVLQRWEGGDSNS 238
            |||..||:       |||.|.|::        || ||.....::.:.||.    ||.|.||:.:.
 Worm   163 MVFHYSDI-------VDFAYVTQEIKKQHAVSKFVTDRQYHGDTPIEGEE----LQEWNGGEEDG 216

Human   239 DDYDLESDM-----------SN------GWDPNEMFKFNEENYGVKTTYDSSLSSYTVPLEKDNS 286
            ....:|.|:           ||      ||..|:||..||: ..|.:|:...|:.||. :|...:
 Worm   217 LGGSIEDDVVVAGGQTAARRSNNHNNGTGWSVNDMFAANEK-MNVVSTFKEDLTQYTT-VEVVGT 279

Human   287 EEFRQRELRAAQLAREIESSPQYRLRIAMENDD----------------GRTEEEKHSAVQRQGS 335
            :|.|   .||.:|||||||:...:....:||||                |...:..:::..:|..
 Worm   280 DEDR---ARAERLAREIESNSSSKFMANLENDDDERDLDKITRQEDFENGNGRKRNNNSFNQQQQ 341

Human   336 GRESPSLASREGKYIPLPQRVREGPRGGVR------CSSSRGGRPGLSSLPPRGPHHLDNSSPGP 394
            .|.:|::|. .|:  |:.:|. ||.||..|      .::||.|.|..:.     .::..|.....
 Worm   342 QRRNPNIAP-NGQ--PVNRRA-EGLRGDRRNSGSSSANNSRYGAPAAAQ-----QNYSQNQQQQQ 397

Human   395 G---------------SEARGINGGPSRMSPKAQ------RPLRGAKTLSSPSNRPSGETSVPPP 438
            |               ::.:|.|.|......:.|      ||....|.....:...:..|:....
 Worm   398 GQKGYRRQNEENDWQMAKGKGQNQGHDHSFRQQQKQMLDPRPNNNVKPADDKAQSATTATAAAGG 462

Human   439 PAAPPFLPVGRMYP-PRSPKSAAPAPISASCPEPPIGSA---VPTSSASIPVTSSVSDPGVGSIS 499
            .........|..:. ..:||..|||     .|....|||   .|.||.....:|:.|.|      
 Worm   463 SRVTDLKNWGNEFSIATAPKDQAPA-----VPAGNSGSAWNRGPPSSLVAKGSSNESTP------ 516

Human   500 PASPKISLAPTDVKELSTKEPGRTLEPQELARIAGKVPGLQNEQKRFQLEELRKFGAQFKLQPSS 564
            |.:       |:.:|..||:........::|  |..|..:||:.::.|.::          ..|.
 Worm   517 PPT-------TNGEEAETKKEEAPSTSVDVA--AAPVQNVQNDAEKHQEDD----------NVSV 562

Human   565 SPENSLDPFPPRILKEEPKGKEKEVDGLLTSEPMGSPVSSKTESVSDKEDKPPLAPSGGTE---- 625
            :.||                     |.::||:.     ||...:::..|.||.:||:..|.    
 Worm   563 TSEN---------------------DSVITSKS-----SSFKFNINAPEFKPRVAPATPTATTPV 601

Human   626 ----GPEQPPPPC--PSQTGSPPVGLIKGEDKDEGPVAEQVKKSTLNPNAKEFNPTKPLLSVNKS 684
                .|:|.|.|.  ..|.|.|..|:        |.|                            
 Worm   602 QNEYHPQQQPHPAMMAPQQGPPAPGM--------GMV---------------------------- 630

Human   685 TSTPTSPGPRTHSTPSIPVLTAGQSGLYSPQYISYIPQIHMGPAVQAPQMYPYPVSNSVPGQQ-G 748
              .|...||:....|  |::...|:|........| ||.|..|....|.       ..||||. |
 Worm   631 --PPHMGGPQNQGQP--PMMMWQQTGQQQQGGGGY-PQNHQFPIQHVPM-------QGVPGQMYG 683

Human   749 KYRGAKGSLPPQRSDQHQ-PASAPPMMQAAAAAG-----PPLVAATPYSSYIPYNPQQFPGQPAM 807
            .......::..|.:.||| |.||..........|     .||        |:||.|.|.  .|..
 Worm   684 PGAATPVTVAQQPNQQHQVPTSAAGGQNHQLRDGEYREKQPL--------YMPYGPPQM--VPVT 738

Human   808 MQPMAH--YPSQPVFAPMLQSNPRMLTSGSHPQAIVSSSTPQYPSAEQPTPQALYATVHQSYPHH 870
            .|...|  |..|     |.|:.|.                 |.....|..||..|...:|     
 Worm   739 SQQFYHSQYQGQ-----MQQAAPY-----------------QMKMMPQQAPQGAYQQRYQ----- 776

Human   871 ATQLHAHQPQP-ATTPTGSQPQSQHAAPSPVQQHQAGQAPHLGSGQPQQNLY---------HPGA 925
                   |||. ...|.|.|.|.::..|.|.||.|        ..||||..:         ||.:
 Worm   777 -------QPQVYMMPPQGQQQQPRYQGPPPPQQQQ--------QQQPQQQQFSGEQSRPQSHPNS 826

Human   926 LTGTPPSLPPGPSAQSPQ-SSFPQPAAVYAIHHQQLPHGFTNMAHVTQAHVQTGITAAPPPHPGA 989
            ...|     |||..:.|: |..||...:.|       ...:|.:|......|:|..:..|  |||
 Worm   827 QPTT-----PGPRGELPKMSGAPQNGNMQA-------ESSSNASHSGSTSSQSGQRSGSP--PGA 877

Human   990 -PHPPQVMLLHPPQSHGGPPQGAVPQSGVPALSASTPSP----------YPYI----------GH 1033
             |.||.....|..|.|  ||..|.|..|.|.........          ||.|          .|
 Worm   878 VPPPPPPQQQHQQQQH--PPHHAPPHVGAPPPQMMQQQQQHIQQYMQVFYPMIMPQQMPMQQNQH 940

Human  1034 PQ----GEQPGQAPGFP--GGADDRILCRVGRSHSRRR----------------QGLAPGSVLCF 1076
            ||    ||:..|  |||  |..|.|.:....:...:::                ||:.|......
 Worm   941 PQQSLMGERSDQ--GFPTSGYFDYRTMPNYQQQQQQQQQQMHRQNSLPQQFQGNQGVNPSGQQSG 1003

Human  1077 PPSSLSCDPAAPLPTASP 1094
            ||     .|..|....:|
 Worm  1004 PP-----PPPPPSQQGTP 1016

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATXN2LXP_005255118.1 SM-ATX 122..191 CDD:291131 15/71 (21%)
PBP1 209..750 CDD:227507 137/616 (22%)
LsmAD 264..326 CDD:284215 22/78 (28%)
TFIIA 763..>948 CDD:281188 53/204 (26%)
TFIIA 882..>1074 CDD:281188 62/245 (25%)
atx-2NP_001255079.1 Sm_like 108..172 CDD:294186 15/71 (21%)
LsmAD 259..319 CDD:284215 21/64 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2325702
eggNOG 1 0.900 E1_COG5180
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I3972
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001718
OrthoInspector 1 1.000 T389917
orthoMCL 1 0.900 OOG5_132032
Panther 1 1.100 LDO PTHR12854
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2220
TreeFam 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.