DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATXN2L and atxn2l

Sequence 1:XP_005255118.1 Gene:ATXN2L HGNCID:31326 Length:1104 Species:Homo sapiens
Sequence 2:NP_001135685.1 Gene:atxn2l XenbaseID:XB-GENE-6000372 Length:970 Species:Xenopus tropicalis

Alignment Length:1095 Identity:671/1096 (61%)
Similarity:761/1096 (69%) Gaps:173/1096 (16%)


Human     1 MLKPQPLQQPSQPQQPPPTQQAVARRPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLGPVAAA 65
            |||.|......:|...|..||       |....|||.|         |||               
 Frog     1 MLKQQQAPPSRKPAMAPAQQQ-------GSPGSPNGNL---------PPG--------------- 34

Human    66 GSGLRRGAEGILAPQPPPPQQHQERPGAAAIGSARGQSTGKGPPQSPVFEGVYNNSRMLHFLTAV 130
            ||                  :.|:||||     .||::..|| .|.|||||||||||||||||||
 Frog    35 GS------------------RSQDRPGA-----GRGRNIVKG-LQPPVFEGVYNNSRMLHFLTAV 75

Human   131 VGSTCDVKVKNGTTYEGIFKTLSSKFELAVDAVHRKASEPAGGPRREDIVDTMVFKPSDVMLVHF 195
            |||||||:|:||..||||||||||:|||||||||:|.|:...||:||||||||:||||||.:|.|
 Frog    76 VGSTCDVRVRNGGVYEGIFKTLSSRFELAVDAVHKKTSDQVMGPKREDIVDTMIFKPSDVAVVGF 140

Human   196 RNVDFNYATKDKFTDSAIAMNSKVNGEHKEKVLQRWEGGDSNSDDYDLESDMSNGWDPNEMFKFN 260
            |||||||||||||||||||.:||||||||||||.||:||::::|||:|:||||||||||:|||||
 Frog   141 RNVDFNYATKDKFTDSAIATSSKVNGEHKEKVLMRWDGGEASNDDYELDSDMSNGWDPNDMFKFN 205

Human   261 EENYGVKTTYDSSLSSYTVPLEKDNSEEFRQRELRAAQLAREIESSPQYRLRIAMENDDGRTEEE 325
            |:.|||||||||||||||:||||||||||||||:||.|||||||||||||.|||:||||.|||||
 Frog   206 EDTYGVKTTYDSSLSSYTIPLEKDNSEEFRQREMRATQLAREIESSPQYRARIAIENDDCRTEEE 270

Human   326 KHSAVQRQGSGRESPSLASREGKYIPLPQRVREGPRGGVRCSSSRGGRPGLSSLPPRG-PHHLDN 389
            |||||||..|.|:||||.||:|||||||||||||.|||:|.||:|||||.:||:|.|| |.|...
 Frog   271 KHSAVQRPNSDRDSPSLGSRDGKYIPLPQRVREGARGGIRTSSARGGRPVMSSMPARGTPQHYPE 335

Human   390 SSPGPGSEARGINGGPSRMSPKAQRPLRGAKTLSSPSNRPSGETSVPPPPAAPPFLPVGRMYPPR 454
            :|..|..|.||:||||||||||||||:|..||:||||:||   ..|...|:|      .|.|||.
 Frog   336 TSSSPVPEQRGMNGGPSRMSPKAQRPIRCTKTMSSPSSRP---VEVSTSPSA------SRAYPPL 391

Human   455 SPKSAAPAPISASCPE-PPIGSAVPTSSASIPVTSSVSDPGVGSISPASPKIS----------LA 508
            ||||.:    |.||.: .|:|:   :|.|::|...:.::|.:.. .|||||.|          :|
 Frog   392 SPKSGS----SVSCADSSPLGT---SSQATLPEPRAAAEPTLAP-KPASPKSSTPILLGEGKEIA 448

Human   509 PTDVKELSTKEPGRTLE---PQELARIAGKVPGLQNEQKRFQLEELRKFGAQFKLQPSSSPENSL 570
            |..|||.|     ||.|   |.::|:...||  ||.:|||.||:|||||||:|:|||||:|:...
 Frog   449 PAAVKEQS-----RTPEQVAPSQVAKQPCKV--LQTDQKRNQLDELRKFGAEFRLQPSSAPDPLS 506

Human   571 DPFPPRILKEEPKGKEKEVDGLLTSEPMGSPVSSKTESVSDKEDKPPLAPSGGTEGPE-----QP 630
            :.||.|           :.|.|                    |.|.|||.:...||.|     :.
 Frog   507 ESFPLR-----------QRDTL--------------------EAKVPLAETAACEGVEPLDIKKV 540

Human   631 PP--------------PCPSQTGSPPVGLIKGEDKDEGPVAEQVKKSTLNPNAKEFNPTKPLLSV 681
            |.              .||.::.||| |..:.|:|:|..|.:||||||||||||||||:||||||
 Frog   541 PELVEELKEERSCEVVECPEESASPP-GKAESEEKEEQAVCDQVKKSTLNPNAKEFNPSKPLLSV 604

Human   682 NKSTSTPTSPGPRTHST-PSIPVLTAGQSGLYSPQYISYIPQIHMGPAVQAPQMYPYPVSNSVPG 745
            ||:||||||||||.||: .:||:|||||:|:|.| ||||||.|||..|||||||||||||:||||
 Frog   605 NKATSTPTSPGPRNHSSAATIPMLTAGQTGVYGP-YISYIPPIHMSSAVQAPQMYPYPVSSSVPG 668

Human   746 QQGKYRGAKGSLPPQRSDQHQPASAPPMMQAAAAAGPPLVAATPYSSYIPYNPQQFPGQPAMMQP 810
            |||||| ||||| |||||  ||.||||:||||||||||||||||||.||.|:||||||||.||||
 Frog   669 QQGKYR-AKGSL-PQRSD--QPNSAPPIMQAAAAAGPPLVAATPYSPYISYSPQQFPGQPTMMQP 729

Human   811 MAHYPSQPVFAPMLQSNPRMLTSGSHPQAIVSSSTPQYPSAEQPTPQALYATVHQSYPHHATQLH 875
            ||||.|||||||||||||||||||:||||:||||.||||.|||||||.|||.|||||.|||.|||
 Frog   730 MAHYSSQPVFAPMLQSNPRMLTSGNHPQALVSSSNPQYPPAEQPTPQTLYAAVHQSYSHHAAQLH 794

Human   876 AHQPQPATTPTGSQPQSQHAAPSPVQQHQAGQAPHLGSGQPQQNLYHPGALTGTPPSLPPGPSAQ 940
               ||||:|||.||.|.|||.|||| |||.||.|||.||||||||||...||.|||||.||||||
 Frog   795 ---PQPASTPTQSQQQPQHANPSPV-QHQTGQPPHLSSGQPQQNLYHTATLTATPPSLTPGPSAQ 855

Human   941 SPQSSFPQPAAVYAIH-HQQLPHGFTNMAHVTQAHVQTGITAAP---------PPHPGAPHPPQV 995
            |||||:|| .|||||| ||||.|.:|||:||.|||||||||.||         |||||||||.||
 Frog   856 SPQSSYPQ-QAVYAIHAHQQLQHSYTNMSHVAQAHVQTGITGAPPPPHPGAPHPPHPGAPHPAQV 919

Human   996 MLLHPPQSHGGPPQGAVPQSGVPALSASTPSPYPYIGH--PQGEQPGQAPGFPGG 1048
            |||||.|:||||||.|:.|:||     |:||||.|:||  .|...|.|.|..|.|
 Frog   920 MLLHPSQTHGGPPQAAIQQTGV-----SSPSPYAYLGHHQVQSHPPQQLPFHPPG 969

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATXN2LXP_005255118.1 SM-ATX 122..191 CDD:291131 56/69 (81%)
PBP1 209..750 CDD:227507 332/576 (58%)
LsmAD 264..326 CDD:284215 56/62 (90%)
TFIIA 763..>948 CDD:281188 150/185 (81%)
TFIIA 882..>1074 CDD:281188 120/180 (67%)
atxn2lNP_001135685.1 SM-ATX 67..136 CDD:291131 56/69 (81%)
PBP1 154..680 CDD:227507 339/585 (58%)
LsmAD 209..271 CDD:284215 56/62 (90%)
PAM2 583..598 CDD:284542 15/15 (100%)
TFIIA 681..>863 CDD:281188 153/188 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C366820320
eggNOG 1 0.900 E1_COG5180
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H16513
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D116171at7742
OrthoFinder 1 1.000 FOG0001718
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.