DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: WIF1 and Ten-m

Sequence 1:NP_009122.2 Gene:WIF1 HGNCID:18081 Length:379 Species:Homo sapiens
Sequence 2:NP_001262211.1 Gene:Ten-m FlyBaseID:FBgn0004449 Length:3349 Species:Drosophila melanogaster

Alignment Length:231 Identity:70/232 (30%)
Similarity:89/232 (38%) Gaps:53/232 (23%)


Human   154 VIVMNSEGNTILQTPQNAIFFKTCQQ---AECPGGCRNGGFCNERRICECPDGFHGPHCEKALCT 215
            |.:.|.:|:.     |...|:....:   ..||.||...|.|.... |:|..||.|..|.:::|.
  Fly  1045 VSLYNDDGDV-----QELTFYAAVAEDMTQNCPNGCSGNGQCLLGH-CQCNPGFGGDDCSESVCP 1103

Human   216 PRCMNGGLCVTPGFCICPPGFYGVNCDKAN--CSTT-CFNGGTCFYPGKCICPPGLEGEQCEISK 277
            ..|...|. .|.|.|||.||:.|..|...:  |... |...|.| ..|||.|..|.:|:.||...
  Fly  1104 VLCSQHGE-YTNGECICNPGWKGKECSLRHDECEVADCSGHGHC-VSGKCQCMRGYKGKFCEEVD 1166

Human   278 CPQP--------------CRNGGK-----------------CIG-------KSKCKCSKGYQGDL 304
            ||.|              |:.|.|                 |.|       ...|.|...:.||.
  Fly  1167 CPHPNCSGHGFCADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDD 1231

Human   305 CSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKR 340
            |||.:|:..||.||.| |.:.|.|...|.|.:||.|
  Fly  1232 CSKELCDLDCGQHGRC-EGDACACDPEWGGEYCNTR 1266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
WIF1NP_009122.2 WIF 35..179 CDD:128745 5/25 (20%)
Ten-mNP_001262211.1 TNFRSF 1069..1198 CDD:304602 42/132 (32%)
CRD2 1106..1151 CDD:276900 17/47 (36%)
EGF_2 1139..1162 CDD:285248 9/24 (38%)
Keratin_B2 1162..1330 CDD:279797 31/107 (29%)
EGF_2 1167..1194 CDD:285248 6/27 (22%)
DUF3844 1171..>1235 CDD:289707 12/64 (19%)
EGF_2 <1272..1294 CDD:285248
NHL 1750..2065 CDD:302697
NHL repeat 1784..1830 CDD:271320
NHL repeat 1854..1888 CDD:271320
NHL repeat 1911..1950 CDD:271320
NHL repeat 1972..2005 CDD:271320
NHL repeat 2039..2065 CDD:271320
RHS_repeat 2183..2218 CDD:283287
RhsA 2347..3020 CDD:225750
YD_repeat_2x 2795..2836 CDD:273728
Rhs_assc_core 2905..2980 CDD:274730
Tox-GHH 3193..3268 CDD:292269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1225
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.