DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: WIF1 and slow

Sequence 1:NP_009122.2 Gene:WIF1 HGNCID:18081 Length:379 Species:Homo sapiens
Sequence 2:NP_647898.3 Gene:slow FlyBaseID:FBgn0035539 Length:512 Species:Drosophila melanogaster

Alignment Length:286 Identity:64/287 (22%)
Similarity:95/287 (33%) Gaps:91/287 (32%)


Human   108 SLDKGIMADP-------------TVNVPLLGT-VPHKASVVQVGFPCLGKQ-DGVAAFEVDVIVM 157
            ::.:|...||             ||.:|:..| |..:.:...|..||.... .|.....|.|:..
  Fly   230 TIGRGYPTDPKEMERRHICMQQRTVTMPVKRTEVYSRPTWKHVATPCQPPTFSGQKCTRVQVVHE 294

Human   158 NSEGNTILQTPQNAIFFKTCQQAE---CPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCM 219
                    |..::.|..||.||..   |.|..|.    |.|          ...|.|.:|:.||.
  Fly   295 --------QAYRDVIDHKTAQQMTYDCCTGWSRE----NPR----------SDSCMKPICSARCQ 337

Human   220 NGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISK-CPQPCR 283
            |||.|..|..|.||.||.|..|::                         :.::|:..| |.|.|.
  Fly   338 NGGNCTAPSTCSCPTGFTGRFCEQ-------------------------DVDECQTEKPCDQQCI 377

Human   284 NGGKCIGKSKCKCSKGY--QGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYE---- 342
            |   ..|...|:|.:|:  |.|       :..|....|       ...:.:..|......:    
  Fly   378 N---THGSYFCRCRQGFVLQSD-------QQSCKKVST-------NADDAFEARDLENDIDDTDA 425

Human   343 --ASLIHALRPAGAQLRQHTPSLKKA 366
              |:.:..:..:.|..|.||..|:|:
  Fly   426 EVATRLQKIEKSLANERVHTNELQKS 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
WIF1NP_009122.2 WIF 35..179 CDD:128745 19/86 (22%)
slowNP_647898.3 EMI 246..318 CDD:284877 19/80 (24%)
EGF_CA <336..360 CDD:238011 13/24 (54%)
EGF_CA 362..401 CDD:214542 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14949
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.