DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: WIF1 and dnt

Sequence 1:NP_009122.2 Gene:WIF1 HGNCID:18081 Length:379 Species:Homo sapiens
Sequence 2:NP_001260567.1 Gene:dnt FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster

Alignment Length:158 Identity:39/159 (25%)
Similarity:73/159 (46%) Gaps:17/159 (11%)


Human    12 LWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQR 76
            :|:.| ||.|.||:..:|......|.::::..:...|:|...::..|.||.:..:..:|      
  Fly    24 MWVLS-LLALAALQLHSGSEVAAHLNVFLNPVEVMRLLGVSAEVYYVREGHINNYALNF------ 81

Human    77 MPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCL 141
            :..:|.|:..::||||:.......|. :::.|.|:.::..|.:||...|.:|.......:...| 
  Fly    82 IVPVPANVKDISFTWQSLAGRGLPYS-INVVSSDQEVLPRPAINVSHSGEIPTTIQTWSIALKC- 144

Human   142 GKQDGVAAFEVDV-----IVMNSEGNTI 164
               .|:.|.||||     :|:|...|.:
  Fly   145 ---SGLKAAEVDVTVSLEVVLNRSLNNV 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
WIF1NP_009122.2 WIF 35..179 CDD:128745 31/136 (23%)
dntNP_001260567.1 WIF 46..182 CDD:128745 31/136 (23%)
PKc_like 310..580 CDD:304357
Pkinase_Tyr 317..573 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.