DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: WIF1 and Ten-a

Sequence 1:NP_009122.2 Gene:WIF1 HGNCID:18081 Length:379 Species:Homo sapiens
Sequence 2:NP_001162732.2 Gene:Ten-a FlyBaseID:FBgn0267001 Length:3387 Species:Drosophila melanogaster

Alignment Length:328 Identity:84/329 (26%)
Similarity:129/329 (39%) Gaps:109/329 (33%)


Human   107 RSLDKGIMADPTVNVPLLGTVPHKASVVQVGFP---CLGKQ---DGVAAFEVDVIVMNSEGNTIL 165
            ||.|.....|  |..||.....|   :.::|.|   .:.|:   ||:.|.:||.:.:|.   ::|
  Fly   842 RSFDSSESYD--VETPLDTAKQH---LQRIGKPQSHWVNKRSAGDGLPALDVDAMTVNV---SLL 898

Human   166 QTPQNAIFFKT--------------CQQAE-----CPGGCRNGGFCNERRICECPDGFHGPHCEK 211
            |.....::|.:              .::||     ||..|...|.|...: |:|.||:.|..|.|
  Fly   899 QYLDTGLWFISVYNDELVAHSVSLLAEEAEGVSTTCPNDCSGRGSCYLGK-CDCIDGYQGVDCSK 962

Human   212 ALC----------------------------------TPRCMNGGLCVTPGFCICPPGFYGVNCD 242
            ::|                                  .|.|.:.|.|: .|.|.|..|:.|..||
  Fly   963 SVCPVLCSAHGHYGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCI-EGECHCERGWKGPYCD 1026

Human   243 KANC-STTCFNGGTCFYPGKCICPPGLEGEQC-----EISKCPQPC-RNG------GKCI----- 289
            :.:| ...|...||| ..|:|.|..|.:||.|     ::.:|...| .:|      |:|:     
  Fly  1027 QHDCLDPLCSGHGTC-VAGQCYCKAGWQGEDCGTIDQQVYQCLPGCSEHGTYDLETGQCVCERHW 1090

Human   290 --------------GKS------KCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHG 334
                          |::      ||:|:.|:.|:||.:..|:..|..||.| :...|.|.:||:|
  Fly  1091 TGPDCSQAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPCDSRCSEHGQC-KNGTCVCSQGWNG 1154

Human   335 RHC 337
            |||
  Fly  1155 RHC 1157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
WIF1NP_009122.2 WIF 35..179 CDD:128745 20/92 (22%)
Ten-aNP_001162732.2 EGF_2 934..960 CDD:285248 10/27 (37%)
Keratin_B2 998..1162 CDD:279797 49/164 (30%)
EGF_2 <1003..1025 CDD:285248 8/23 (35%)
EGF_2 1032..1057 CDD:285248 10/26 (38%)
EGF_2 <1071..1095 CDD:285248 4/24 (17%)
EGF_2 1101..1126 CDD:285248 7/25 (28%)
EGF_2 <1135..1157 CDD:285248 11/23 (48%)
EGF_CA 1163..1192 CDD:238011
NHL 1622..1927 CDD:302697
NHL repeat 1675..1721 CDD:271320
NHL repeat 1745..1787 CDD:271320
NHL repeat 1802..1847 CDD:271320
NHL repeat 1864..1897 CDD:271320
RHS_repeat 2213..2250 CDD:283287
RhsA 2397..2958 CDD:225750
Rhs_assc_core 2939..3015 CDD:274730
Tox-GHH 3274..3349 CDD:292269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1225
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.