DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: WIF1 and shf

Sequence 1:NP_009122.2 Gene:WIF1 HGNCID:18081 Length:379 Species:Homo sapiens
Sequence 2:NP_001284963.1 Gene:shf FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster

Alignment Length:342 Identity:115/343 (34%)
Similarity:170/343 (50%) Gaps:40/343 (12%)


Human    32 QEESLYLWIDAHQARVLI------GFEEDILIVSEGKMAPFTHDFRKAQ-QRMPAIPVNIHSMNF 89
            :|..:.|||:..|.::|.      |:.|.:..:...::   |:|.|... .....||..::.:||
  Fly   113 EESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRV---TNDLRDTTLYNFLVIPSEVNYVNF 174

Human    90 TWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDV 154
            ||: :|:.:|||:|..|:::|:.|:..||:::...|.:|.:.....:..||.|...|.|:|.|.:
  Fly   175 TWK-SGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGL 238

Human   155 IVMNSEGNTILQTPQNAIFFKTCQ------------------QA---ECPGGCRNGGFCNERRIC 198
            .:.......:..||....|.|.|.                  ||   ||...|...|:|||..||
  Fly   239 KIQTRHNKPLSGTPIRLNFKKECAHRGVYDIDASNPTSLTTLQAPDPECSLKCGKNGYCNEHHIC 303

Human   199 ECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCI 263
            :|..|:.|.:||.|.|.|:|:|||.|..|..|.||.|:.|..|:...|...|.|||.|....||.
  Fly   304 KCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQ 368

Human   264 CPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLC-----SKPVCEPGCGAHGTCHEP 323
            |..|..|.:||.|||..||:|.|:|||.:.|:|..|.:||.|     .:.:|:  | .:|||...
  Fly   369 CSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICK--C-RNGTCVSH 430

Human   324 NKCQCQEGWHGRHCNKR 340
            ..|:|..|::|||||.|
  Fly   431 KHCKCHPGFYGRHCNGR 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
WIF1NP_009122.2 WIF 35..179 CDD:128745 40/169 (24%)
shfNP_001284963.1 WIF 137..258 CDD:280237 33/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1225
Hieranoid 1 1.000
Homologene 1 1.000 H31430
Inparanoid 1 1.050 228 1.000 Inparanoid score I3409
Isobase 1 0.950 0 Normalized mean entropy S5912
OMA 1 1.010
OrthoDB 1 1.010 D1016037at2759
OrthoFinder 1 1.000 FOG0003187
OrthoInspector 1 1.000 T1075478
orthoMCL 1 0.900 OOG5_136443
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.625 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4825
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.