DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: WIF1 and NimB2

Sequence 1:NP_009122.2 Gene:WIF1 HGNCID:18081 Length:379 Species:Homo sapiens
Sequence 2:NP_723857.1 Gene:NimB2 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster

Alignment Length:220 Identity:71/221 (32%)
Similarity:93/221 (42%) Gaps:55/221 (25%)


Human   156 VMNSEGNTILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMN 220
            |..:||..|               :.||.||.| |.|:||..|:|.:|:......:..|.|.|..
  Fly   207 VRTAEGKCI---------------STCPLGCGN-GVCDERNECKCREGYSLEPETRKYCQPECKP 255

Human   221 G---GLCVTPGFCICPPGFYGVNCDKANCSTTC--FNGGTCFYPGKCICPPG---LEGEQCEISK 277
            |   |.||.|..|.|..| |.:..| .:|...|  ...|.|..||.|.|..|   |:| :|| ..
  Fly   256 GCSFGRCVAPNKCACLDG-YRLAAD-GSCEPVCDSCENGKCTAPGHCNCNAGYLKLQG-RCE-PI 316

Human   278 CPQPCRNGGKCIGKSKCKCSKGYQGDLCSK---PVCEPGCGAHGTCHEPNKCQCQEGW----HGR 335
            |..||:| |:|||...|:|:.|::.|..|.   |.|:..| .:|.|...|:|.|:.|:    |.|
  Fly   317 CSIPCKN-GRCIGPDICECASGFEWDRKSAECLPKCDLPC-LNGVCVGNNQCDCKTGYVRDEHQR 379

Human   336 -----HCNKRYEASLIHALRPAGAQ 355
                 ||             |.|.|
  Fly   380 NICQPHC-------------PQGCQ 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
WIF1NP_009122.2 WIF 35..179 CDD:128745 4/23 (17%)
NimB2NP_723857.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003187
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.