DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AP4S1 and or

Sequence 1:NP_009008.2 Gene:AP4S1 HGNCID:575 Length:159 Species:Homo sapiens
Sequence 2:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster

Alignment Length:117 Identity:44/118 (37%)
Similarity:65/118 (55%) Gaps:6/118 (5%)


Human     1 MIKFFLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLSRSNEQCSFIE------YKDFKLIY 59
            |||..|:.|..|:.||||:|::.|.:.:..:..|..:....|.:..|:|:|      ..|:||||
  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65

Human    60 RQYAALFIVVGVNDTENEMAIYEFIHNFVEVLDEYFSRVSELDVSFFNTVFH 111
            |.||.|:.|..|:.:|:|:.|.:.|..|||.||:.|..|.|||:.|.....|
  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVH 117

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AP4S1NP_009008.2 Clat_adaptor_s 1..>105 CDD:261170 42/110 (38%)
orNP_536793.1 APS2 1..143 CDD:227363 44/118 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.