DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: KAT7 and mof

Sequence 1:NP_008998.1 Gene:KAT7 HGNCID:17016 Length:611 Species:Homo sapiens
Sequence 2:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster

Alignment Length:598 Identity:195/599 (33%)
Similarity:288/599 (48%) Gaps:108/599 (18%)


Human    66 GTEEPAYSTRRVTRSQ--QQPTPVTPKKYPLRQTRSSGSETEQVV------------DFSDRETK 116
            |.|.||.......||:  |:.||..|.:...|..|........||            ..||..::
  Fly   268 GEEPPAVYLSPYIRSRYMQESTPGLPTRLAPRDPRQRNMPPPAVVLPIQTVLSANVEAISDDSSE 332

Human   117 NTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYNF 181
            .::..|:........:|.:.|.|      |.|.:..|.....|... .|:|..|.:..|      
  Fly   333 TSSSDDDEEEEEDEDDALTMEHD------NTSRETVITTGDPLMQK-IDISENPDKIYF------ 384

Human   182 NMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQDDN--- 243
                       :....|...|...:......:..:.||..|.....:::::..:..||..||   
  Fly   385 -----------IRREDGTVHRGQVLQSRTTENAAAPDEYYVHYVGLNRRLDGWVGRHRISDNADD 438

Human   244 -------------------------NRHATRHQAPTERQLRYKEKVAELRKKRNS-------GLS 276
                                     .:.|....|.:|||.|...|...|....||       .::
  Fly   439 LGGITVLPAPPLAPDQPSTSREMLAQQAAAAAAASSERQKRAANKDYYLSYCENSRYDYSDRKMT 503

Human   277 KEQKEKYME--HRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKT 339
            :.||.:|.|  |.|             .|..:|...:.|..:..|.:.|::          .|..
  Fly   504 RYQKRRYDEINHVQ-------------KSHAELTATQAALEKEHESITKIK----------YIDK 545

Human   340 IAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSI 404
            :.||.||:||||.||:||||.:...||:||:|||||:.::....|:.:|..:.|||.||||||:|
  Fly   546 LQFGNYEIDTWYFSPFPEEYGKARTLYVCEYCLKYMRFRSSYAYHLHECDRRRPPGREIYRKGNI 610

Human   405 SVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLN 469
            |::||:||:..:|||.|||:||||||||.||:|::|||||::.|.|..|.|::|||||||.|..|
  Fly   611 SIYEVNGKEESLYCQLLCLMAKLFLDHKVLYFDMDPFLFYILCETDKEGSHIVGYFSKEKKSLEN 675

Human   470 YNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLH-N 533
            |||:|||.:|.:.|:|:||:||.|||.||:.|..:||||:||||||.:||||||...||..:. .
  Fly   676 YNVACILVLPPHQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSDLGRLSYRSYWAYTLLELMKTR 740

Human   534 FQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIA----KEAKRSNS 594
            ...::|:|||:|:.:.:...||:.|||:::|:|||||::::......|.:.:.    |:.|    
  Fly   741 CAPEQITIKELSEMSGITHDDIIYTLQSMKMIKYWKGQNVICVTSKTIQDHLQLPQFKQPK---- 801

Human   595 NKTMDPSCLKWTP 607
             .|:|...|.|:|
  Fly   802 -LTIDTDYLVWSP 813

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KAT7NP_008998.1 zf-C2HC 184..212 CDD:334581 2/28 (7%)
PLN00104 <324..609 CDD:215056 137/290 (47%)
Acetyl-CoA binding. {ECO:0000250|UniProtKB:Q9H7Z6} 475..477 2/2 (100%)
Acetyl-CoA binding. {ECO:0000250|UniProtKB:Q9H7Z6} 482..488 3/6 (50%)
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 8/67 (12%)
NAT_SF 528..813 CDD:302625 139/300 (46%)
MOZ_SAS 599..778 CDD:280097 103/179 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D285390at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126735
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.