DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BTN3A1 and side-VII

Sequence 1:NP_008979.3 Gene:BTN3A1 HGNCID:1138 Length:513 Species:Homo sapiens
Sequence 2:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster

Alignment Length:422 Identity:89/423 (21%)
Similarity:138/423 (33%) Gaps:150/423 (35%)


Human    10 LLLNFRVCLLLLQLLMPHSAQFSVLG----PSGPILAMVGEDADLPCHLFPTMSAETMELKWVSS 70
            |||.|.:.|.|::         |.:|    |...|.::|||:..|||::......|.:.:.|   
  Fly     3 LLLLFMLALQLIE---------SSIGSKDVPIHQIESIVGENIYLPCNVTTYDGDEPVLVLW--- 55

Human    71 SLRQVVNVYADGK-----EVEDR---QSAPYRGRTSILRDGITAGKA---------ALRIHNVTA 118
                    |.|.|     .::.|   ..||.|...    |.:...:|         .|.|.|..|
  Fly    56 --------YRDDKGTPIYSIDIRAGVSKAPKRWSD----DSVFGDRAYFIFDKEPGKLSIQNTQA 108

Human   119 SDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKG---------------------YKDGGI 162
            ||||.|.|..   ||       ||...:.|.:.::|..                     |.:|.|
  Fly   109 SDSGTYRCRV---DF-------LKAQTINSRIRLNVISPPKQVIIRDSSNVERSTVVGPYSEGDI 163

Human   163 -HLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSL 226
             .|:|:..|.||.|.|.|               ..||:.:....:.:    :.|:.:.|.|....
  Fly   164 VSLKCQVIGGYPTPTISW---------------YRDGIEIPCELSHL----AGGKIIECEITLPS 209

Human   227 LGLE----KTASISIADPFFRSAQRWIAALAGTLPVLLLLLG-------GAGYFL---------- 270
            ||.|    :....:::.|.....:..:.......|:.:.|||       |..|.|          
  Fly   210 LGREDLNSRLTCRALSHPRAPIVEAVVQIDMNFAPLNIRLLGAHQPLSAGRRYDLLCQSAGSRPP 274

Human   271 -----WQQ--QEEKKTQFRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYAS-RGERHS 327
                 ||.  :.||.|:.......|....::.|..|.:..              :|.| :...|:
  Fly   275 AVITWWQNGIRLEKTTETTSSDGNQTTSTLSISLSKSDAG--------------KYLSCKAYNHA 325

Human   328 AYNE-----WKKAL-FKPADVI-----LDPKT 348
            ..:|     ||..: :.|...:     |||.|
  Fly   326 VPSEPLEDGWKLDIQYVPEAYVRLGTSLDPST 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BTN3A1NP_008979.3 IG_like 37..143 CDD:214653 32/123 (26%)
Ig_MOG_like 45..144 CDD:143190 30/116 (26%)
SPRY_PRY_BTN3 337..512 CDD:293992 5/18 (28%)
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 32/127 (25%)
V-set 32..134 CDD:284989 32/127 (25%)
IGc2 160..>214 CDD:197706 18/73 (25%)
Ig 262..328 CDD:299845 13/80 (16%)
IG_like 264..323 CDD:214653 11/73 (15%)
IGc2 360..425 CDD:197706
Ig_3 456..519 CDD:290638
FN3 538..620 CDD:238020
FAM176 643..741 CDD:291517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.