DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AKR1C4 and CG2767

Sequence 1:NP_001809.3 Gene:AKR1C4 HGNCID:387 Length:323 Species:Homo sapiens
Sequence 2:NP_649757.1 Gene:CG2767 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster

Alignment Length:325 Identity:121/326 (37%)
Similarity:192/326 (59%) Gaps:19/326 (6%)


Human    11 NDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRSKIADGSVK 75
            |:|..|||:|.||:...:.....|::.   |:|||:||||:|.:|.||:.:|..::..:..|.||
  Fly    10 NNGEKMPVIGIGTWQASDEEIETAIDA---ALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK 71

Human    76 REDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPMALKPGETPLPK-DENGKVIF 139
            ||::|..:|:.....:|..|:|.::.||:.||||||||||:|.|..:...|....| |:.|.:..
  Fly    72 REELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEV 136

Human   140 D-TVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKPGLKYKPVCNQVECHPYLNQSKLL 203
            | |.:.:|.|..||...:.||.||||||||:..|:..:|.  ..|.:|..||:|.|.||.|..|:
  Fly   137 DVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDLV 199

Human   204 DFCKSKDIVLVAHSALGTQ-----RHKLWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR 263
            |||||::|.:.|:|.||::     .....:..:.|.|::.|.:..:|..|.:|||.:.||:.:..
  Fly   200 DFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDT 264

Human   264 GVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDF-----LMDHPDYPFSDEY 323
            ||..:.||.|..|:::|:.||:|:||:|::..|..|::|.|  :.||     :..||::.|.::|
  Fly   265 GVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIR--ICDFAFFHGVERHPEFTFKNQY 327

Human   324  323
              Fly   328  327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AKR1C4NP_001809.3 ARA1 7..310 CDD:223729 116/306 (38%)
Tas 17..297 CDD:223739 109/287 (38%)
CG2767NP_649757.1 ARA1 5..302 CDD:223729 113/297 (38%)
Tas 10..297 CDD:223739 111/292 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1016440at2759
OrthoFinder 1 1.000 FOG0000053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11732
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.