DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: WWP1 and Nedd4

Sequence 1:NP_008944.1 Gene:WWP1 HGNCID:17004 Length:922 Species:Homo sapiens
Sequence 2:NP_648993.1 Gene:Nedd4 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster

Alignment Length:1116 Identity:342/1117 (31%)
Similarity:484/1117 (43%) Gaps:373/1117 (33%)


Human     7 RSDTSNNHSG-RLQLQVTVSSAKLKRKKNWFGTA----------IYTEVVVDGEITKTAKSSSSS 60
            ||..:.|.|| ...|::.|.:.:...||:.||.:          |..::.:|..:|||.|  .:.
  Fly    58 RSLAAVNDSGDSCHLRIVVLTGQSLAKKDIFGASDPYVRIDLNTINGDINIDSVLTKTKK--KTL 120

Human    61 NPKWDEQLTVNVTP-QTTLEFQVWSHRTLKADALLGKATIDLKQALLIHNRKLERVKEQLKLSLE 124
            ||.|:|:....|.| :..|.|||:....|..|..||..                           
  Fly   121 NPTWNEEFIFRVKPSEHKLVFQVFDENRLTRDDFLGMV--------------------------- 158

Human   125 NKNGIAQTGELTVVLDGLVIEQENITNCSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGI 189
                     |||:|  .|..|||..|....|.|:             .|.....|:..::||..|
  Fly   159 ---------ELTLV--NLPTEQEGRTIGEQSYTL-------------RPRRSVGAKSRIKGTLRI 199

Human   190 DNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDN 254
            .:.....|..|                                  |||:....:||         
  Fly   200 YHAFIRETREQ----------------------------------SEPSSGNSDGE--------- 221

Human   255 ASVTGTPVVSEENALSPNCTSTTVEDPPVQEILTSSENNECIPSTSAELESEARSILEPDTSNSR 319
                      .|:..:.|...|:.:..|.                                    
  Fly   222 ----------WEHVEATNAGETSAQPHPF------------------------------------ 240

Human   320 SSSAFEAAKSRQPDGCMDPVRQQSGNANTETLPSGWEQRKDPHGRTYYVDHNTRTTTWERP---- 380
                        |.|..|            .||:|||:|:|.:||||||:|..|||.|:||    
  Fly   241 ------------PTGGHD------------ALPAGWEERQDANGRTYYVNHTARTTQWDRPTVLN 281

Human   381 --------QPLPPGWERR----VDDR---RRVYYVDHNT-------------------------- 404
                    ..|...::||    |||.   |....:.||:                          
  Fly   282 SHSSQSTDDQLASDFQRRFHISVDDTESGRSADSISHNSIEDNNNAAGLAYTPKTAATSSAPPNT 346

Human   405 ---------------RTTTWQRPTME-----------------------SVRN------------ 419
                           |....|.||::                       |::|            
  Fly   347 PTNNNGILAQIAMQYRAEEDQDPTVDHTSFVYNSLRHPVAHRQPEISATSLQNDLRPVREAPGVP 411

Human   420 -------FEQ-----------WQSQ--RNQLQGAMQQFNQRYLY--------------------- 443
                   |.:           ||.:  |.|:|..:||..||...                     
  Fly   412 DIAITNPFTRRAAGNMAGGAGWQQERRRQQMQLHIQQHQQRQQQQQQNRILLDVDHRQQEPQHRG 476

Human   444 -------------------------------------SASMLAAENDPYG---PLPPGWEKRVDS 468
                                                 :|::...|.:..|   ||||.|..:|..
  Fly   477 QRHQQQHRPSNEDTDHTDSHNPSDISAPSTRRNSEEDNAAVPPMEQNTGGEEEPLPPRWSMQVAP 541

Human   469 TDRVYFVNHNTKTTQWEDPR----------TQGLQNE-EPLPEGWEIRYTREGVRYFVDHNTRTT 522
            ..|.:|::|.::.|.|.|||          |:.:::: .|||||||.|...:|..:::|||||||
  Fly   542 NGRTFFIDHASRRTTWIDPRNGRASPMPNQTRRVEDDLGPLPEGWEERVHTDGRVFYIDHNTRTT 606

Human   523 TFKDPRNGKSSVTKGGPQIAYERGFRWKLAHFR-YLCQSNALPSHVKINVSRQTLFEDSFQQIMA 586
            .::|||....::  .|..:.|.|.::.|..:|: ::.:...:|:..:|.:.|.::.|||::.|.:
  Fly   607 QWEDPRLSNPNI--AGQAVPYSRDYKQKYEYFKSHIRKPTNVPNKFEIRIRRTSILEDSYRIISS 669

Human   587 LKPYD-LRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTI- 649
            :...| |:.:|:|.|.||.||||||||||||:|||.|:.||.|.||||:..:||.||||..|.: 
  Fly   670 VTKTDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQINNGSGLC 734

Human   650 NPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNN 714
            |.:|||||.||||...||::|||.:|..|..||||.||.|.:.:||:||:|||:||||:||::|:
  Fly   735 NEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIKEND 799

Human   715 IEECGLEMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDG 779
            ...  ||:.|.:|.::.|:.:.|:||.||:||.||.|||||||.|:.||||...|:||..:||||
  Fly   800 PRI--LELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDG 862

Human   780 FNEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYR-HYTRNSKQIIWFWQFVKETDNEVR 843
            |..::||..::.|||.|||:::||:|.:|:.||:.||:|: .|..|...|.|||:.|....||:|
  Fly   863 FGSIIPLNLIKIFDEHELELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMR 927

Human   844 MRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYKSYEQLKEK 908
            .|||||||||.|:|:.||.||.||||||.|.|||.|.....||:||||||||||||:.|.|||:|
  Fly   928 SRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWGTPNNFPRAHTCFNRLDLPPYEGYLQLKDK 992

Human   909 LLFAIEETEGF 919
            |:.|||.::||
  Fly   993 LIKAIEGSQGF 1003

Known Domains:


GeneSequenceDomainRegion External IDIdentity
WWP1NP_008944.1 C2_E3_ubiquitin_ligase 17..140 CDD:175988 30/134 (22%)
HUL4 <307..922 CDD:227354 284/805 (35%)
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999 42/186 (23%)
WW 248..277 CDD:278809 19/29 (66%)
WW 531..560 CDD:278809 11/29 (38%)
WW 581..613 CDD:197736 19/32 (59%)
HECTc 650..1003 CDD:238033 192/355 (54%)
HECTc 674..1003 CDD:214523 186/331 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000148
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127296
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.