DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ERP29 and wbl

Sequence 1:NP_006808.1 Gene:ERP29 HGNCID:13799 Length:261 Species:Homo sapiens
Sequence 2:NP_001286609.1 Gene:wbl FlyBaseID:FBgn0004003 Length:257 Species:Drosophila melanogaster

Alignment Length:257 Identity:81/258 (31%)
Similarity:137/258 (53%) Gaps:16/258 (6%)


Human    18 LLGFLLLSAPHG---GSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAEN 79
            :|..|||.|.|.   ...:...|.:.||.::|.|.:.:..:.:||||..||||||.:.|...:::
  Fly     4 ILVTLLLVAIHSIPTTWAVTCTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKS 68

Human    80 S-ASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFR-DGDFENPVPYTGAVKVGAIQ 142
            : .::.|||:|.||:.|||:..|..|.::||:|.:::|..:||: :.|....:|....|.:..::
  Fly    69 AHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLK 133

Human   143 RWLKGQ-GVYLGMPGCLPVYDALAGEFIRASGVEARQAL--LKQGQDNLSSVKETQKKWAEQYLK 204
            .::... .:|:|..||:..::.:...:......|..:.:  |:..|:.|:..::.|.  |..||.
  Fly   134 AFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQN--ARAYLI 196

Human   205 IMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQ-----KKGAEKEEL 261
            .|.||.:.|.||...|..|:.|| :..|:::.|||||.:.||||..|:     |...|||||
  Fly   197 YMRKIHEVGYDFLEEETKRLLRL-KAGKVTEAKKEELLRKLNILEVFRVHKVTKTAPEKEEL 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ERP29NP_006808.1 PDI_a_ERp29_N 36..149 CDD:239305 36/116 (31%)
ERp29 156..251 CDD:311614 30/97 (31%)
ER retrieval sequence 258..261 3/3 (100%)
wblNP_001286609.1 ERp29_N 22..147 CDD:254509 38/125 (30%)
ERp29 149..242 CDD:285048 29/96 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C294562377
eggNOG 1 0.900 E1_28K2V
Hieranoid 1 1.000
Homologene 1 1.000 H4963
Inparanoid 1 1.050 117 1.000 Inparanoid score I4726
Isobase 1 0.950 0 Normalized mean entropy S7243
OMA 1 1.010
OrthoDB 1 1.010 D1535651at2759
OrthoFinder 1 1.000 FOG0010916
OrthoInspector 1 1.000 T1072468
orthoMCL 1 0.900 OOG5_135364
Panther 1 1.100 LDO PTHR12211
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4822
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.