DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NPFFR2 and RYa-R

Sequence 1:NP_004876.2 Gene:NPFFR2 HGNCID:4525 Length:522 Species:Homo sapiens
Sequence 2:NP_001287552.1 Gene:RYa-R FlyBaseID:FBgn0004842 Length:518 Species:Drosophila melanogaster

Alignment Length:365 Identity:117/366 (32%)
Similarity:180/366 (49%) Gaps:47/366 (13%)


Human   151 IISYFL---IFFLCMMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAG 212
            ||.|.|   ||...::||..||:||.....|.||||.||.:|||.|:|:..||:|.:.:...|..
  Fly   106 IIVYMLYIPIFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILN 170

Human   213 -WPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITI 276
             ||||..:|......|.:||..|.:|||||::||:..:::|.||::|.:.|..||..:|.:|:..
  Fly   171 YWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALAT 235

Human   277 MSPSAVM---------LHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLA 332
            ..|..::         .|.:.|||.               |||.||::.....||..|||..::.
  Fly   236 ALPIPIVSGLDIPMSPWHTKCEKYI---------------CREMWPSRTQEYYYTLSLFALQFVV 285

Human   333 PLSLIVIMYGRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMM 397
            ||.:::..|.||.|.::....|.....|::|  .::|.|:|::||:|.|.::|...|||...|.:
  Fly   286 PLGVLIFTYARITIRVWAKRPPGEAETNRDQ--RMARSKRKMVKMMLTVVIVFTCCWLPFNILQL 348

Human   398 L---SDYADLSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRA 459
            |   .::|...|..      |::...||||..:...|||||.:.|..||.||     :||..:..
  Fly   349 LLNDEEFAHWDPLP------YVWFAFHWLAMSHCCYNPIIYCYMNARFRSGF-----VQLMHRMP 402

Human   460 KPMEAYALKAKSHVLINTSNQLVQESTFQNPHGETLLYRK 499
            .......|::....:..||.::   :|..:.|....|:||
  Fly   403 GLRRWCCLRSVGDRMNATSGEM---TTKYHRHVGDALFRK 439

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NPFFR2NP_004876.2 7tm_4 155..>277 CDD:304433 50/126 (40%)
7tm_1 164..435 CDD:278431 95/284 (33%)
RYa-RNP_001287552.1 7tm_4 113..>234 CDD:304433 49/121 (40%)
7tm_1 122..383 CDD:278431 95/284 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3897
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.