DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NPFFR2 and SIFaR

Sequence 1:NP_004876.2 Gene:NPFFR2 HGNCID:4525 Length:522 Species:Homo sapiens
Sequence 2:NP_001163674.1 Gene:SIFaR FlyBaseID:FBgn0038880 Length:758 Species:Drosophila melanogaster

Alignment Length:411 Identity:137/412 (33%)
Similarity:226/412 (55%) Gaps:22/412 (5%)


Human   122 NDTK---HHLYSDINITYVNYYLHQPQVAAIFIISYFLIFFLCMMGNTVVCFIVMRNKHMHTVTN 183
            ||:.   ..|...::..:...|.|...::.::.::|.::|.:.::||:.|..:|:|...|.||||
  Fly   180 NDSALRWEQLDGSVDFGFDPLYRHSLAMSMVYCVAYIVVFLVGLIGNSFVIAVVLRAPRMRTVTN 244

Human   184 LFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQC 248
            .||:||||:|:||.:||:|.||:.||...|..|..|||....:||:||||||::|:|:::|||..
  Fly   245 YFIVNLAIADILVIVFCLPATLIGNIFVPWMLGWLMCKFVPYIQGVSVAASVYSLIAVSLDRFIA 309

Human   249 VVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLH-VQEEKYYRVRLNSQNKTSPVYWCREDW 312
            :.:|.| ::|.:.|.::|:.|||:|:....|..:... |..|:.:...|.|. .:.|.:.|:|.|
  Fly   310 IWWPLK-QMTKRRARIMIIGIWVIALVTTIPWLLFFDLVPAEEVFSDALVSA-YSQPQFLCQEVW 372

Human   313 PNQEMRKIYTTVLFANI---YLAPLSLIVIMYGRIGISLFRAAVPHTGRKNQEQWHVVSRK-KQK 373
            |......:|  .|.||:   ||.|:|||.:.|..|.|.:...::|  |.....|...:.:| |.|
  Fly   373 PPGTDGNLY--FLLANLVACYLLPMSLITLCYVLIWIKVSTRSIP--GESKDAQMDRMQQKSKVK 433

Human   374 IIKMLLIVALLFILSWLPLWTLMMLSDY-ADLSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGF 437
            :||||:.|.:||:||||||:.:.....: :|:|..|.:|:. .:.|.|.||...||.:|||:|. 
  Fly   434 VIKMLVAVVILFVLSWLPLYVIFARIKFGSDISQEEFEILK-KVMPVAQWLGSSNSCINPILYS- 496

Human   438 FNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQLVQESTFQNP--HGETLLYRKS 500
            .|:.:||||....:.:.|..|.:..:..|: |.|......|:...|.|:.::|  .|..:.|...
  Fly   497 VNKKYRRGFAAIIKSRSCCGRLRYYDNVAI-ASSTTSTRKSSHYHQNSSRKSPSSKGNAVSYIYE 560

Human   501 AEKPQQELVMEELKETTNSSE 521
            ....::..:|  ||:.:|.|:
  Fly   561 HNSLRRHNMM--LKQDSNLSQ 579

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NPFFR2NP_004876.2 7tm_4 155..>277 CDD:304433 54/122 (44%)
7tm_1 164..435 CDD:278431 108/277 (39%)
SIFaRNP_001163674.1 7tm_4 216..>443 CDD:304433 88/233 (38%)
7tm_1 225..495 CDD:278431 108/277 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C81006907
eggNOG 1 0.900 E33208_3BBX5
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H56982
Inparanoid 1 1.050 210 1.000 Inparanoid score I3619
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000759
OrthoInspector 1 1.000 T609316
orthoMCL 1 0.900 OOG5_135274
Panther 1 1.100 O PTHR24241
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.