DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NPFFR2 and NPFR

Sequence 1:NP_004876.2 Gene:NPFFR2 HGNCID:4525 Length:522 Species:Homo sapiens
Sequence 2:NP_001246947.1 Gene:NPFR FlyBaseID:FBgn0037408 Length:489 Species:Drosophila melanogaster

Alignment Length:378 Identity:108/379 (28%)
Similarity:185/379 (49%) Gaps:60/379 (16%)


Human   116 HPIWNVN-DTKHHL------YSDINIT--------YVNYYLHQPQVAA----IFIISYFLIFFLC 161
            ||:..:: .|.|.|      .||:|.|        .::.:|....|.:    :.|..|.::....
  Fly    36 HPLDYLDLGTVHALNTTAINTSDLNETGSRPLDPVLIDRFLSNRAVDSPWYHMLISMYGVLIVFG 100

Human   162 MMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFG--NTMCKISG 224
            .:|||:|...|:|...|.|..|||||||||||||:.:..||:||::.:...||:|  :.:||...
  Fly   101 ALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIA 165

Human   225 LVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEE 289
            ::|.:.:..|..::.|||.||:|.:|||.:..|....|..|:..||.||:.:.||..|       
  Fly   166 MLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTILAGIWALALLLASPLFV------- 223

Human   290 KYYRVRLNSQNKT--------SPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMY----- 341
              |:..:|:....        ..:.:|.||||::..|..|:.......||.|:.::.:.|     
  Fly   224 --YKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYN 286

Human   342 ---GRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYAD 403
               .||.:...:|:   :.::..|:    .|:.::...:|:.:|::|.:||||   |...:.|||
  Fly   287 KLKSRITVVAVQAS---SAQRKVER----GRRMKRTNCLLISIAIIFGVSWLP---LNFFNLYAD 341

Human   404 LSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQ 456
            :..:.:....:..|...|.:...::..||::||:.|:|||:.|||.    ||:
  Fly   342 MERSPVTQSMLVRYAICHMIGMSSACSNPLLYGWLNDNFRKEFQEL----LCR 390

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NPFFR2NP_004876.2 7tm_4 155..>277 CDD:304433 48/124 (39%)
7tm_1 164..435 CDD:278431 84/289 (29%)
NPFRNP_001246947.1 7tm_4 98..>195 CDD:304433 41/97 (42%)
7tm_1 103..373 CDD:278431 84/289 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3897
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.