DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NPFFR2 and CG30340

Sequence 1:NP_004876.2 Gene:NPFFR2 HGNCID:4525 Length:522 Species:Homo sapiens
Sequence 2:NP_724812.2 Gene:CG30340 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster

Alignment Length:354 Identity:93/355 (26%)
Similarity:165/355 (46%) Gaps:62/355 (17%)


Human   106 KWDTNSSENWHPIWNVNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFL-IFFLCMMGNTVVC 169
            |||..:...|                         ||:|.....:.|..|| :....:.||..:.
  Fly    14 KWDFPAERIW-------------------------LHKPNGEITWKICTFLPLIAFGLYGNFSMV 53

Human   170 FIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAAS 234
            :::..|:.:.:.|||.|.|:|::|||....|..:.::::....:..|...||:.|.:..:.:..:
  Fly    54 YVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQLGCVGCKLEGFLVVVFLITA 118

Human   235 VFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQ 299
            |..|..::.||...:|.|.:.:|||:...::::..||..|.:.||.|..      :.||||: .:
  Fly   119 VLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLASPLAFY------RSYRVRV-WK 176

Human   300 NKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKNQEQW 364
            |.|.  .:|:|   |..:...|..||...:...||.:::|.|    |::|.       :.::.:.
  Fly   177 NFTE--RYCKE---NTSVLPKYWYVLITILVWLPLGIMLICY----IAIFY-------KLDRYEK 225

Human   365 HVVSRK-------KQKIIKMLLIVALLFILSWLPLWTLMMLSDY---ADLSPNELQIINIYIYPF 419
            .|:||:       |:.:.|.|.||.::|....||...|::|.:.   .|:|.:....:..||   
  Fly   226 RVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLREKYFGEDVSVSSGMQLFWYI--- 287

Human   420 AHWLAFGNSSVNPIIYGFFNENFRRGFQE 448
            :.:|.|.|::|||:||||.||||||.:.:
  Fly   288 SQYLMFLNAAVNPLIYGFNNENFRRAYYQ 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NPFFR2NP_004876.2 7tm_4 155..>277 CDD:304433 31/123 (25%)
7tm_1 164..435 CDD:278431 74/281 (26%)
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 83/297 (28%)
7tm_1 48..303 CDD:278431 74/281 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1308959at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.