DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CYSLTR1 and AstC-R1

Sequence 1:NP_001269115.1 Gene:CYSLTR1 HGNCID:17451 Length:337 Species:Homo sapiens
Sequence 2:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster

Alignment Length:302 Identity:74/303 (24%)
Similarity:140/303 (46%) Gaps:18/303 (6%)


Human    14 CHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPL 78
            |..|.:.|.:.....||..:.::|.|||..|:||:::....::...:|::||||||...:..:|.
  Fly    68 CIATRNSFADLFTVVLYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPF 132

Human    79 RVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFV 143
             ::|.:....|.||:|:|:....:..:..:.|..|:..||..|.||:..|:.:....|...|:.|
  Fly   133 -LLYTMRICSWRFGEFMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVV 196

Human   144 CVGIWIFVILTSSPFLM--AKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIII 206
            ....|....:...|.::  :..::::..|..|.....|...|:........:.|:||..|...|:
  Fly   197 SAIAWSTSAVLMLPVILYASTVEQEDGINYSCNIMWPDAYKKHSGTTFILYTFFLGFATPLCFIL 261

Human   207 VCYTMIILTLLK-------KSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNET 264
            ..|.::|..|..       ||.:|. .:|:|...:::.|.:.:::.::|:.|.:...:|     :
  Fly   262 SFYYLVIRKLRSVGPKPGTKSKEKR-RAHRKVTRLVLTVISVYILCWLPHWISQVALIH-----S 320

Human   265 KPCDSVLRMQKSVVITL--SLAASNCCFDPLLYFFSGGNFRK 304
            .|....|...:.::..|  :|..||...:|:||.|...||||
  Fly   321 NPAQRDLSRLEILIFLLLGALVYSNSAVNPILYAFLSENFRK 362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYSLTR1NP_001269115.1 7tm_4 32..>163 CDD:304433 34/133 (26%)
7tm_1 40..295 CDD:278431 61/266 (23%)
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 69/283 (24%)
7tm_1 94..353 CDD:278431 61/266 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.