DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ADCY2 and ACXB

Sequence 1:NP_065433.2 Gene:ADCY2 HGNCID:233 Length:1091 Species:Homo sapiens
Sequence 2:NP_620474.2 Gene:ACXB FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster

Alignment Length:1185 Identity:320/1186 (27%)
Similarity:533/1186 (45%) Gaps:217/1186 (18%)


Human     4 EAMRRRRYLRDRSEEAAGGGDGLPRSRDWLYESYYCMSQQHPLIVFLLLIVMGSCLALLAVFFAL 68
            |.:..|.||:.:.:|                   .|:.:::......|:|...:....|.:|..:
  Fly    19 ERLWERGYLKAKCKE-------------------LCLEEEYKKYQIRLMISYLTVFFPLFIFVVV 64

Human    69 GLEV------EDH----------VAFLITVPTALAI-FFAIFILVCIESVFKKLLRLFSLVIWIC 116
            |.|:      |..          :..|:.||..|:| ||..|:|      ..:.:.:||.::...
  Fly    65 GCELCPWIFSEQKKLIYYESLTAIVVLVAVPGILSINFFESFVL------RHRWIMVFSSILSAY 123

Human   117 LVAMGYLFMCFGGTVSPWDQVSFF-------------LFIIFVVYTMLPF-NMRDAIIASVLTSS 167
            :|.:..:|           |:..|             :|::.::|..||. ::|.   |::|.:|
  Fly   124 IVVLVDIF-----------QILVFHFKYHWPLNTLYDVFVLCMIYMFLPIPSIRG---AALLATS 174

Human   168 SHTIVLSVCLSATPGGKE------HLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNC 226
            ...:.:.:.:.......|      |.:..|..::..::..||.|.:.:.:.:..::.::.|....
  Fly   175 VSLMYIGLFIYFLKSDDEDISEVVHDLDTICVDIFHYLGFNLMGIFFRIMNDTMVRSSFLDRHQF 239

Human   227 IKSRIKLEFEKRQQERLLL-SLLPAHIAMEMKAEIIQRLQGPKAG------QMENTNNFHNLYVK 284
            :|..:.|. :.||||.:|| |:||..||..::..|.:|:...:..      ....|.||  :.::
  Fly   240 LKEEMWLR-QARQQESMLLDSILPPQIAKPIQQSIKERIMLSETDSDRIVVNARRTENF--MAIQ 301

Human   285 RHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPI 349
            .|.:|||||||:|.:|.|.:..:..:||.:|::|:|:||..|...:..|||.||||||||:||..
  Fly   302 IHPDVSILYADVVNYTHLTTTLTVEKLVKVLHDLYGRFDMAASTFKVQRIKFLGDCYYCVAGLGE 366

Human   350 SLPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLAN 414
            :.|:||:..|.:|:.|...|::||....:||:||:|||||.:|.||||..|.|||:|..||.:||
  Fly   367 ADPDHARMAVSLGISMIANIQEVRAHRALDIDMRIGVHSGTLLAGVIGQAKLQYDIWGPDVDIAN 431

Human   415 HMEAGGVPGRVHISSVTLEHLNGA-YKVEEGDGDIR-DPYLKQHLVKTYFVINPKGERRSPQHLF 477
            .:||.|.||.||:|..||..||.| |.|..|....: ||.|::..:.||.               
  Fly   432 RLEATGKPGYVHVSGRTLSSLNVAEYTVFPGTEVAQSDPILQKQPMTTYL--------------- 481

Human   478 RPRHTLDGAKMRASVRMTRYLESW--------GAAKPFAHLHHRDSMTTENGKISTTDVPMGQHN 534
                 |..|..|.|||....:.|:        ||::....|  |.::.::..:.....:|:|..|
  Fly   482 -----LTAAPSRNSVRSVDAVHSYAEIDINALGASRKSPIL--RPTLMSDELREEFKKMPVGGFN 539

Human   535 FQNRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPA 599
            .::...|..|.    :|::|                   ..:....:.|.:..||..|.......
  Fly   540 IRSPCCRDNSN----DEKVN-------------------HGLGMFCVAFKDSSLEWSYLHKPDFI 581

Human   600 FKYYVTCACLIFFCIFIVQIL-----VLPKTSVLGI---SFGAAFLLLAFILFVCFAGQLLQCSK 656
            .||.|..|..|..|:..:||:     :..:..|:.:   :|..:.|.:::...||:...:...|:
  Fly   582 LKYSVLLAWGIGCCLIYIQIVNDKFTICVECIVIDMVVFTFLTSLLFISWFKKVCWWRCVENDSR 646

Human   657 KASPLLMWLLKSSGIIANRPWPRISLTIITTAIILMMAVFNMFFLSDSEETIPPTANTTNTSFSA 721
            |...:...|.|.        |.||..:.:....|.|..|.:.:.|.   .||....:........
  Fly   647 KYGRVSCKLFKI--------WERIQHSFVLRVTIYMSIVASYYLLI---STILLNCDKNQYELDV 700

Human   722 SNNQV--AILRAQNLFFLPYFIYSCILGLISCS-VFLRVNYELKMLIMMVALVGYNTILLHTHAH 783
            .|:::  ..:...|. |.|:.....|..::..| .|.|:.:.|||||...|.|.|..|:...::.
  Fly   701 INSKLYHYDIVTDNC-FNPWVFTDMISLIVGVSYTFARIPFALKMLITCCATVAYLVIVFFQYSF 764

Human   784 VLGDYSQVLFERPGI---WKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKKEREEI 845
            :        ||....   :...:....:.:.:..:|:....||:|:..:::|......:.:::..
  Fly   765 I--------FEHSATTTPFMKAELAHCLRVCMMLLTMYAKERQSEFNTKINFKINQDLQGKQKAA 821

Human   846 ETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGL 910
            :.......:||.|:||:||.|.:| .|:.|.|||:::|..|.||||.:.:|          :..|
  Fly   822 DITNKSIIILLTNILPSHVVEVYL-DSVANHELYYENYKMVSVMFAMLINF----------QMDL 875

Human   911 ECLRLLNEIIADFDDLLSKPK-FSGVEKIKTIGSTYMAATGL------SAVPSQEH--------- 959
            ..||:||:||.:||.||:..| :..|||||.:|.|||||.||      |...|:.|         
  Fly   876 PSLRVLNDIITEFDRLLNAYKEYYVVEKIKVVGCTYMAACGLDFTLAKSKFGSRTHASYSSELEQ 940

Human   960 ------SQEPERQYMHIG-TMVEFAFALVGKLDAINK--------HSFNDFKLRVGINHGPVIAG 1009
                  |:..|..:..:. .|..||..|:..|...||        .:.:..::.:||:.|.::||
  Fly   941 VLYRKESKGTENDHDEVAFIMTTFALDLMRVLSVCNKAYAGRPFDRALSTGEICIGISTGEIMAG 1005

Human  1010 VIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTY 1074
            |:||.:|.||||||.||:||||:|||:...|.||:||:.:|:.....|..||:..|||:|::.||
  Fly  1006 VVGASQPHYDIWGNPVNMASRMESTGLPGHIHVTQETANILEQFDIMCMYRGMTFVKGRGEIPTY 1070

Human  1075 FVNTEMSRSLSQSNV 1089
            ||..:.:.....|||
  Fly  1071 FVGIDDNLKFLPSNV 1085

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ADCY2NP_065433.2 AC_N <33..260 CDD:292831 51/265 (19%)
CYCc 236..439 CDD:214485 93/211 (44%)
Guanylate_cyc 281..465 CDD:278633 85/186 (46%)
DUF1053 495..599 CDD:283888 16/112 (14%)
CYCc 848..1056 CDD:214485 88/239 (37%)
Guanylate_cyc 878..1077 CDD:278633 87/230 (38%)
Interaction with GNAS. {ECO:0000250|UniProtKB:P26769} 905..922 7/17 (41%)
Interaction with GNAS. {ECO:0000250|UniProtKB:P26769} 990..993 0/3 (0%)
ACXBNP_620474.2 AC_N <36..276 CDD:292831 51/261 (20%)
CYCc 249..459 CDD:214485 94/212 (44%)
Nucleotidyl_cyc_III 298..484 CDD:299850 86/206 (42%)
CYCc 825..1047 CDD:214485 88/233 (38%)
Nucleotidyl_cyc_III 853..1072 CDD:299850 86/229 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110509139
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5262
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D181177at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45627
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.